Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-18R1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse IL-18R1 aa 182-336. (Expressed in E.coli).
    Sequence:

    CVFSVHHNGTRYNITKTVNITVIEGRSKVTPAILGPKCEKVGVELGKDVE LNCSASLNKDDLFYWSIRKEDSSDPNVQEDRKETTTWISEGKLHASKILR FQKITENYLNVLYNCTVANEEAIDTKSFVLVRKEIPDIPGHVFTGGVTVL VLASV


    Database link: Q61098

  • Positive control

    • WB: Recombinant mouse IL18R1 protein; Mouse stomach and pancreas lysates. IHC-P: Mouse pancreas and colon tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 62 kDa.

Target

  • Function

    Receptor for interleukin 18 (IL-18). Binding to the agonist leads to the activation of NF-kappa-B.
  • Tissue specificity

    Expressed in lung, leukocytes, spleen, liver, thymus, prostate, small intestine, colon, placenta, and heart, and is absent from brain, skeletal muscle, pancreas, and kidney. High level of expression in Hodgkin disease cell lines.
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD218 antigen-like family member A antibody
    • CD218a antibody
    • CDw218a antibody
    • CDw218a antigen antibody
    • IL 1Rrp antibody
    • IL-18R-1 antibody
    • IL-18R1 antibody
    • IL-1Rrp antibody
    • IL1 receptor related protein antibody
    • IL1 receptor-related protein antibody
    • IL18R_HUMAN antibody
    • IL18R1 antibody
    • IL18RA antibody
    • Il18ralpha antibody
    • IL1R-rp antibody
    • IL1RRP antibody
    • Interleukin 18 receptor 1 antibody
    • Interleukin 18 receptor, alpha chain antibody
    • Interleukin-18 receptor 1 antibody
    see all

Images

  • Anti-IL-18R1 antibody (ab231565) at 2 µg/ml + Recombinant mouse IL18R1 protein

    Predicted band size: 62 kDa

  • Anti-IL-18R1 antibody (ab231565) at 2 µg/ml + Mouse stomach lysate

    Predicted band size: 62 kDa

  • Anti-IL-18R1 antibody (ab231565) at 2 µg + Mouse pancreas lysate

    Predicted band size: 62 kDa

  • All lanes : Anti-IL-18R1 antibody (ab231565) at 2 µg/ml

    Lane 1 : Mouse pancreas lysate
    Lane 2 : Mouse stomach lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 62 kDa

  • Paraffin-embedded mouse colon tissue stained for IL18R1 using ab231565 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse pancreas tissue stained for IL18R1 using ab231565 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231565 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up