Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-1R-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Monkey
  • Immunogen

    Recombinant fragment corresponding to Human IL-1R-2 aa 172-391.
    Sequence:

    DSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNIT RSIELRIKKKKEETIPVIISPLKTISASLGSRLTIPCKVFLGTGTPLTTM LWWTANDTHIESAYPGGRVTEGPRQEYSENNENYIEVPLIFDPVTREDLH MDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLAFLVLGGIWMHR RCKHRTGKADGLTVLWPHHQ

  • Positive control

    • H1299 and 293T lystes SW480 xenograft (IHC-P)
  • General notes

    Previously labelled as IL1 Receptor II.

Properties

Applications

Our Abpromise guarantee covers the use of ab97388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 45 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Receptor for interleukin-1 alpha (IL-1A), beta (IL-1B), and interleukin-1 receptor antagonist protein (IL-1ra).
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • IL1 Receptor II antibody
    • Antigen CDw121b antibody
    • CD121 antibody
    • CD121 antigen-like family member B antibody
    • CD121b antibody
    • CD121B Antigen antibody
    • CDw121b antibody
    • IL 1 type II receptor antibody
    • IL-1R-2 antibody
    • IL-1R-beta antibody
    • IL-1R2 antibody
    • IL-1RT-2 antibody
    • IL-1RT2 antibody
    • IL1R Beta antibody
    • Il1r-2 antibody
    • IL1R2 antibody
    • IL1R2_HUMAN antibody
    • IL1R2c antibody
    • IL1RB antibody
    • Interleukin 1 receptor type II variant 3 antibody
    • Interleukin 1 receptor, beta, type II antibody
    • Interleukin 1 receptor, type II antibody
    • Interleukin-1 receptor beta antibody
    • Interleukin-1 receptor type 2 antibody
    • Interleukin-1 receptor type II antibody
    • MGC137383 antibody
    • MGC47725 antibody
    • OTTHUMP00000207969 antibody
    • p68 antibody
    • Type II interleukin-1 receptor, beta antibody
    see all

Images

  • Anti-IL-1R-2 antibody (ab97388) at 1/1000 dilution + 293T whole cell lysate at 30 µg

    Predicted band size: 45 kDa



    10% SDS PAGE
  • ab97388, at 1/100, staining paraffin-embedded SW480 xenograft by Immunohistochemistry.

References

This product has been referenced in:

  • Wu S  et al. Cooperative effects of hepatitis B virus and TNF may play important roles in the activation of metabolic pathways through the activation of NF-?B. Int J Mol Med 38:475-81 (2016). WB ; Human . Read more (PubMed: 27315566) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab97388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up