Overview

  • Product name
  • Description
    Rabbit polyclonal to IL-1RAcP
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Cow, Human
    Predicted to work with: Rhesus monkey
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human IL-1RAcP aa 65-249. (Expressed in E.coli).
    Sequence:

    GLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTC MLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVD GYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVV TYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPN


    Database link: Q9NPH3

  • Positive control
    • IHC-P: Human lung tissue. WB: Cow thymus lysate; Recombinant human IL-1RAcP protein.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab232950 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 65 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function
    Coreceptor with IL1R1. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Recruits TOLLIP to the signaling complex. Does not bind to interleukin-1 alone; binding of IL1RN to IL1R1, prevents its association with IL1R1 to form a signaling complex. The cellular response is modulated through a non-signaling association with the membrane IL1R2 decoy receptor. Secreted forms (isoforms 2 and 3) associate with secreted ligand-bound IL1R2 and increase the affinity of secreted IL1R2 for IL1B; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors.
  • Tissue specificity
    Detected in liver, skin, placenta, thymus and lung.
  • Sequence similarities
    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • C3orf13 antibody
    • FLJ37788 antibody
    • IL 1 receptor accessory protein antibody
    • IL 1R 3 antibody
    • IL 1R3 antibody
    • IL 1RAcP antibody
    • IL 1RAP antibody
    • IL-1 receptor accessory protein antibody
    • IL-1R-3 antibody
    • IL-1R3 antibody
    • IL-1RAcP antibody
    • IL-1RAP antibody
    • IL1 receptor accessory protein antibody
    • IL1AP_HUMAN antibody
    • IL1R3 antibody
    • IL1RAcP antibody
    • Il1rap antibody
    • Interleukin 1 Accessory Protein antibody
    • interleukin 1 receptor 3 antibody
    • Interleukin 1 receptor accessory protein antibody
    • interleukin 1 receptor accessory protein beta antibody
    • Interleukin-1 receptor 3 antibody
    • Interleukin-1 receptor accessory protein antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human lung tissue stained for IL-1RAcP using ab232950 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-IL-1RAcP antibody (ab232950) at 2 µg/ml + Recombinant human IL-1RAcP protein

    Predicted band size: 65 kDa

  • Anti-IL-1RAcP antibody (ab232950) at 2 µg/ml + Cow thymus tissue lysate.

    Predicted band size: 65 kDa

References

ab232950 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up