Overview

  • Product name

    Anti-IL-1RAPL2 antibody
  • Description

    Rabbit polyclonal to IL-1RAPL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human IL-1RAPL2 aa 128-220.
    Sequence:

    SMSLTVAENESGLCYNSRIRYLEKSEVTKRKEISCPDMDDFKKSDQEPDV VWYKECKPKMWRSIIIQKGNALLIQEVQEEDGGNYTCELKYEG


    Database link: Q9NP60

  • Positive control

    • Human pancreas tissue

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Detected at low levels in fetal and adult brain, in particular in the frontal lobe, temporal lobe and cerebellum. Detected at very low levels in skin, liver, fetal ovary and in placenta.
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • IL 1 RAPL 2 antibody
    • IL 1 receptor accessory protein like 2 antibody
    • IL 1R 9 antibody
    • IL 1R9 antibody
    • IL 1RAPL 2 antibody
    • IL-1 receptor accessory protein-like 2 antibody
    • IL-1-RAPL-2 antibody
    • IL-1R-9 antibody
    • IL-1R9 antibody
    • IL-1RAPL-2 antibody
    • IL1 receptor accessory protein like 2 antibody
    • IL1R9 antibody
    • IL1RAPL 2 antibody
    • IL1RAPL-2 antibody
    • IL1RAPL-2-related protein antibody
    • IL1RAPL2 antibody
    • IL1RAPL2 related protein antibody
    • Interleukin 1 receptor 9 antibody
    • Interleukin 1 receptor accessory protein like 2 antibody
    • Interleukin-1 receptor 9 antibody
    • IRPL2_HUMAN antibody
    • Three immunoglobulin domain containing IL1 receptor related 1 antibody
    • Three immunoglobulin domain-containing IL-1 receptor-related 1 antibody
    • TIGIRR 1 antibody
    • TIGIRR-1 antibody
    • TIGIRR1 antibody
    • X linked interleukin 1 receptor accessory protein like 2 antibody
    • X-linked interleukin-1 receptor accessory protein-like 2 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human pancreas tissue labeling IL1RAPL2 with ab204081 at 1/50 dilution.

References

ab204081 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up