Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human IL-2 aa 1-153.
    Sequence:

    MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINN YKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNF HLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQ SIISTLT


    Database link: P60568

  • Positive control

    • CTLL-2 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 17 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
  • Involvement in disease

    Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17.
  • Sequence similarities

    Belongs to the IL-2 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aldesleukin antibody
    • IL 2 antibody
    • IL-2 antibody
    • IL2 antibody
    • IL2_HUMAN antibody
    • Interleukin 2 antibody
    • Interleukin-2 antibody
    • interleukin2 antibody
    • Involved in regulation of T cell clonal expansion antibody
    • Lymphokine antibody
    • OTTHUMP00000164090 antibody
    • POIL2 antibody
    • T Cell Growth Factor antibody
    • T-cell growth factor antibody
    • TCGF antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver cancer tissue labelling IL2 with ab180780 at 1/100. Magnification: 200x.

References

ab180780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-7 of 7 Abreviews or Q&A

Application
Western blot
Sample
Mouse Cell lysate - whole cell (CT26.WT (ATCC® CRL-2638™) cells)
Gel Running Conditions
Reduced Denaturing (4-20% Tris Glycin Gel, PVDF membrane)
Loading amount
50 µg
Specification
CT26.WT (ATCC® CRL-2638™) cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Jun 26 2019

Application
Immunocytochemistry
Sample
Mouse Cultured Cells (CT26.WT (ATCC® CRL-2638™) cells)
Permeabilization
Yes - 0.1% triton-X100 in PBS
Specification
CT26.WT (ATCC® CRL-2638™) cells
Blocking step
Innovex Background Buster as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jun 25 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (EMT6 (ATCC® CRL-2755™) tumors taken out C57black m)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate pH6 15min boiling
Permeabilization
No
Specification
EMT6 (ATCC® CRL-2755™) tumors taken out C57black m
Blocking step
Innovex Background Buster as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jun 18 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (MDA-MB-231 (ATCC® HTB-26™) tumor taken out of Balb)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate pH:6 15min boiling
Permeabilization
No
Specification
MDA-MB-231 (ATCC® HTB-26™) tumor taken out of Balb
Blocking step
Innovex Background Buster as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jun 18 2019

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (OV90 cells)
Permeabilization
Yes - 0.1% triton-X100 in PBS
Specification
OV90 cells
Blocking step
Innovex Background Buster as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jun 17 2019

Application
Western blot
Sample
Human Cell lysate - whole cell (HT-29 (ATCC® HTB-38™))
Gel Running Conditions
Reduced Denaturing (4-20% Tris Glycin Gel)
Loading amount
50 µg
Specification
HT-29 (ATCC® HTB-38™)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Jun 17 2019

Application
Immunocytochemistry
Sample
Human Cultured Cells (OV90 cells)
Permeabilization
Yes - 0.1% triton-X100 in PBS
Specification
OV90 cells
Blocking step
Innovex Background Buster as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jun 16 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up