Overview

  • Product name

    Anti-IL-2 Receptor alpha antibody
    See all IL-2 Receptor alpha primary antibodies
  • Description

    Rabbit polyclonal to IL-2 Receptor alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Chimpanzee, Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Human IL-2 Receptor alpha aa 22-185.
    Sequence:

    ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNS SHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL PGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMT HGKTRWTQPQLICT


    Database link: P01589

  • Positive control

    • WB: Rat spleen lysate. IHC-P: Human glioma tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 31 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Receptor for interleukin-2.
  • Involvement in disease

    Genetic variations in IL2RA are associated with susceptibility to diabetes mellitus insulin-dependent type 10 (IDDM10) [MIM:601942]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
  • Sequence similarities

    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Interleukin 2 receptor alpha chain antibody
    • CD25 antibody
    • CD25 antigen antibody
    • IDDM10 antibody
    • IL 2 receptor alpha subunit antibody
    • IL-2 receptor subunit alpha antibody
    • IL-2-RA antibody
    • IL-2R subunit alpha antibody
    • IL2 RA antibody
    • IL2 Receptor alpha antibody
    • IL2-RA antibody
    • IL2R antibody
    • IL2R, alpha chain antibody
    • IL2RA antibody
    • IL2RA_HUMAN antibody
    • IMD41 antibody
    • Interleukin 2 receptor alpha antibody
    • Interleukin 2 receptor antibody
    • Interleukin-2 receptor subunit alpha antibody
    • p55 antibody
    • t-cell growth factor receptor antibody
    • TAC antibody
    • TAC antigen antibody
    • TCGFR antibody
    see all

Images

  • Paraffin-embedded human glioma tissue stained for IL2 Receptor alpha using ab235906 at 1/100 dilution in immunohistochemical analysis.

  • Anti-IL-2 Receptor alpha antibody (ab235906) at 1/500 dilution + Rat spleen lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 31 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for IL2 Receptor alpha (green) using ab235906 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab235906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up