Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IL-20 aa 25-176. Full length mature chain without signal peptide.
    Sequence:

    LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDT KPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLR LCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEE TE


    Database link: Q9NYY1

  • Positive control

    • IHC-P: Human testis and endometrial cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Cytokine that may be involved in epidermal function and psoriasis. Acts through STAT3.
  • Tissue specificity

    Expressed at very low levels in skin, trachea, and other tissues.
  • Sequence similarities

    Belongs to the IL-10 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytokine Zcyto10 antibody
    • Four alpha helix cytokine antibody
    • IL-20 antibody
    • IL10D antibody
    • IL20 antibody
    • IL20_HUMAN antibody
    • Interleukin 20 antibody
    • Interleukin-20 antibody
    • MGC96907 antibody
    • UNQ852/PRO1801 antibody
    • ZCYTO10 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for IL20 using ab229809 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrial cancer tissue stained for IL20 using ab229809 at 1/100 dilution in immunohistochemical analysis.

References

ab229809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up