Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-20R1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human IL-20R1 aa 135-171 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    TQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVS


    Database link: Q9UHF4

  • Positive control

    • Human endometrial cancer and rat tongue tissues; rat brain and mouse liver tissue lysates.
  • General notes

    Protein previously labeled as IL20 Receptor alpha.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 0.01% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

WB 1/100 - 1/1000. Detects a band of approximately 60 kDa (predicted molecular weight: 62 kDa).

Target

  • Function

    The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26.
  • Tissue specificity

    Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin.
  • Sequence similarities

    Belongs to the type II cytokine receptor family.
    Contains 2 fibronectin type-III domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • class II cytokine receptor ZCYTOR7 antibody
    • CRF2 8 antibody
    • CRF2-8 antibody
    • Cytokine receptor class II member 8 antibody
    • Cytokine receptor class-II member 8 antibody
    • Cytokine receptor family 2 member 8 antibody
    • I20RA_HUMAN antibody
    • IL 20R alpha antibody
    • IL 20R1 antibody
    • IL-20 receptor subunit alpha antibody
    • IL-20R-alpha antibody
    • IL-20R1 antibody
    • IL-20RA antibody
    • IL20 Receptor alpha antibody
    • IL20RA antibody
    • Interleukin 20 receptor alpha chain antibody
    • Interleukin 20 receptor, alpha antibody
    • interleukin-20 receptor I antibody
    • Interleukin-20 receptor subunit alpha antibody
    • ZcytoR7 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human endometrial cancer tissue labeling IL-20R1 with ab203196 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat tongue tissue labeling IL-20R1 with ab203196 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • All lanes : Anti-IL-20R1 antibody (ab203196) at 1/200 dilution

    Lane 1 : Rat kidney tissue lysate
    Lane 2 : Rat brain tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 62 kDa
    Observed band size: 60 kDa
    why is the actual band size different from the predicted?



    12% Gel.

  • Anti-IL-20R1 antibody (ab203196) at 1/300 dilution + mouse liver tissue lysate

    Secondary
    Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/5000 dilution

    Predicted band size: 62 kDa



    12% Gel.

References

This product has been referenced in:

  • An W  et al. Exogenous IL-19 attenuates acute ischaemic injury and improves survival in male mice with myocardial infarction. Br J Pharmacol N/A:N/A (2018). Read more (PubMed: 30460984) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up