Overview

  • Product name

  • Description

    Goat polyclonal to IL-21R
  • Host species

    Goat
  • Tested applications

    Suitable for: IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide corresponding to Human IL-21R aa 35-65 (N terminal).
    Sequence:

    CILEMWNLHPSTLTLTWQDQYEELKDEATS

  • Positive control

    • Human lung/tonsil.
  • General notes

    Stable for at least 3 years when stored at -80°C

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.1% Sodium Azide
    Constituents: PBS, pH 7.2
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab13321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/300.
ELISA 1/100000.

Target

  • Function

    This is a receptor for interleukin-21.
  • Tissue specificity

    Selectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 2 fibronectin type-III domains.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications

    C-mannosylated at Trp-214 in the WSXWS motif, the sugar chain makes extensive hydrogen bonds with Asn-73 sugar, and bridges the two fibronectin domains transforming the V-shaped receptor into an A-frame.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD360 antibody
    • IL 21R antibody
    • IL-21 receptor antibody
    • IL-21R antibody
    • IL21 receptor antibody
    • IL21R antibody
    • IL21R_HUMAN antibody
    • Interleukin 21 receptor antibody
    • Interleukin-21 receptor antibody
    • MGC10967 antibody
    • NILR antibody
    • Novel interleukin receptor antibody
    see all

Images

  • ab13321 used in IHC staining human lung at 1/300 dilution.

References

ab13321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab13321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up