Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-22
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Neutralising, WBmore details
  • Species reactivity

    Reacts with: Recombinant fragment
    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IL-22 aa 34-179. (Expressed in E.coli).
    Sequence:

    MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHG VSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTC HIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI


    Database link: Q9GZX6

  • Positive control

    • Recombinant Human IL22 protein.

Properties

  • Form

    Lyophilised:reconstitute in water to a concentration 0.1-1.0mg/ml
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab211756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Neutralising Use at an assay dependent concentration.

To yield one-half maximal inhibition [ND50] of the biological activity of Human IL22 (50.0 ng/ml), a concentration of 1.25 μg/ml of this antibody is required.

WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Function

    Cytokine that contributes to the inflammatory response in vivo.
  • Sequence similarities

    Belongs to the IL-10 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytokine Zcyto18 antibody
    • IL 10 related T cell derived inducible factor antibody
    • IL 21 antibody
    • IL 22 antibody
    • IL D110 antibody
    • IL TIF antibody
    • IL-10-related T-cell-derived-inducible factor antibody
    • IL-22 antibody
    • IL-TIF antibody
    • IL21 antibody
    • Il22 antibody
    • IL22_HUMAN antibody
    • ILD110 antibody
    • ILTIF antibody
    • Interleukin 10 related T cell derived inducible factor antibody
    • interleukin 21 antibody
    • Interleukin 22 antibody
    • Interleukin-22 antibody
    • MGC79382 antibody
    • MGC79384 antibody
    • TIFa antibody
    • TIFIL 23 antibody
    • TIFIL23 antibody
    • UNQ3099/PRO10096 antibody
    • zcyto18 antibody
    see all

Images

  • All lanes : Anti-IL-22 antibody (ab211756) at 0.2 µg/ml

    Lane 1 : Recombinant Human IL22 protein at 0.25 µg
    Lane 2 : Recombinant Human IL22 protein at 0.125 µg
    Lane 3 : Recombinant Human IL22 protein at 0.0625 µg
    Lane 4 : Recombinant Human IL22 protein at 0.03125 µg
    Lane 5 : Recombinant Human IL22 protein at 0.015625 µg
    Lane 6 : Recombinant Human IL22 protein at 0.0078 µg
    Lane 7 : Recombinant Human IL22 protein at 0.0039 µg
    Lane 8 : Recombinant Human IL22 protein at 0.00195 µg
    Lane 9 : Recombinant Human IL22 protein at 0.000975 µg
    Lane 10 : Recombinant Human IL22 protein at 0.0004875 µg
    Lane 11 : Recombinant Human IL22 protein at 0.00024 µg

    Performed under non-reducing conditions.

    Predicted band size: 20 kDa



    Detection limit for recombinant Human IL22 is 1.5 - 3.0 ng/lane.

References

ab211756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up