Overview

  • Product name

  • Description

    Mouse polyclonal to IL-22RA1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
  • Immunogen

    Recombinant full length protein corresponding to Human IL-22RA1 aa 1-574.
    Sequence:

    MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPD TVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVS AGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGD GHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGT IMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLS YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ YSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLS YAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWP PSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEV TSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLS SVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPET SDLEQPTELDSLFRGLALTVQWES


    Database link: NP_067081.2

  • Positive control

    • Lysate from 293T cells transfected with IL-22RA1; 293 cells expressing IL-22RA1.

Properties

Applications

Our Abpromise guarantee covers the use of ab167213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 63 kDa. This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.
Flow Cyt Use 1µg for 106 cells.

 

 

 

 

 

ab37355 - Mouse polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • CRF2 9 antibody
    • CRF2-9 antibody
    • Cytokine receptor class-II member 9 antibody
    • cytokine receptor classII member 9 antibody
    • Cytokine receptor family 2 member 9 antibody
    • I22R1_HUMAN antibody
    • IL-22 receptor subunit alpha-1 antibody
    • IL-22R-alpha-1 antibody
    • IL-22RA1 antibody
    • IL22 Receptor Alpha antibody
    • IL22R antibody
    • IL22R1 antibody
    • Il22ra1 antibody
    • ILTIF R1 chain antibody
    • Interleukin 22 Receptor alpha 1 antibody
    • Interleukin 22 Receptor antibody
    • Interleukin-22 receptor subunit alpha-1 antibody
    • ZcytoR11 antibody
    see all

Images

  • FACS analysis of negative control 293 cells (Black) and IL22RA1 expressing 293 cells (Green) using IL22RA1 purified mouse polyclonal antibody ab167213 diluted 1μg/ml.

  • All lanes : Anti-IL-22RA1 antibody (ab167213) at 1/500 dilution

    Lane 1 : Lysate from 293T cells transfected with IL22 Receptor Alpha
    Lane 2 : non transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 63 kDa

References

ab167213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up