Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-22RA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human IL-22RA1 aa 267-565. (Expressed in E.coli).
    Sequence:

    QRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAP QRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAP QVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPT GTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQ PLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPP SRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRG


    Database link: Q8N6P7

  • Positive control

    • WB: Pig spleen lysate; K562 cell lysate; Recombinant human IL-22RA1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 63 kDa.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • CRF2 9 antibody
    • CRF2-9 antibody
    • Cytokine receptor class-II member 9 antibody
    • cytokine receptor classII member 9 antibody
    • Cytokine receptor family 2 member 9 antibody
    • I22R1_HUMAN antibody
    • IL-22 receptor subunit alpha-1 antibody
    • IL-22R-alpha-1 antibody
    • IL-22RA1 antibody
    • IL22 Receptor Alpha antibody
    • IL22R antibody
    • IL22R1 antibody
    • Il22ra1 antibody
    • ILTIF R1 chain antibody
    • Interleukin 22 Receptor alpha 1 antibody
    • Interleukin 22 Receptor antibody
    • Interleukin-22 receptor subunit alpha-1 antibody
    • ZcytoR11 antibody
    see all

Images

  • All lanes : Anti-IL-22RA1 antibody (ab232925) at 3 µg/ml

    Lane 1 : Pig spleen lysate
    Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow ) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 63 kDa

  • Anti-IL-22RA1 antibody (ab232925) at 3 µg/ml + Recombinant human IL-22RA1 protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 63 kDa

References

ab232925 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up