Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-22RA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human IL-22RA1 aa 251-300 (internal sequence).
    Sequence:

    YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ


    Database link: NP_067081

  • Positive control

    • Human fetal kidney cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-IL-22RA1 antibody (ab98917) at 1 µg/ml + Human fetal kidney cell lysate at 10 µg

    Predicted band size: 63 kDa



    12% SDS-PAGE

References

ab98917 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up