Overview

  • Product name

    Anti-IL-23R antibody [ABM25G4]
    See all IL-23R primary antibodies
  • Description

    Mouse monoclonal [ABM25G4] to IL-23R
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human IL-23R aa 250-450.
    Sequence:

    KVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQET GKRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSD NRGDIGLLLGMIVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYED I


    Database link: Q5VWK5

  • Positive control

    • WB: MCF7, THP-1 and A431 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab228426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 2 µg/ml. Predicted molecular weight: 72 kDa.

Target

  • Function

    Associates with IL12RB1 to form the interleukin-23 receptor. Binds IL23 and mediates T-cells, NK cells and possibly certain macrophage/myeloid cells stimulation probably through activation of the Jak-Stat signaling cascade. IL23 functions in innate and adaptive immunity and may participate in acute response to infection in peripheral tissues. IL23 may be responsible for autoimmune inflammatory diseases and be important for tumorigenesis.
  • Tissue specificity

    Expressed by monocytes, Th1, Th0, NK and dendritic cells. Isoform 1 is specifically expressed in NK cells.
  • Involvement in disease

    Genetic variations in IL23R are associated with inflammatory bowel disease type 17 (IBD17) [MIM:612261]. IBD17 is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
    Genetic variations in IL23R are a cause of susceptibility to psoriasis type 7 (PSORS7) [MIM:605606]. Psoriasis is a common, chronic inflammatory disease of the skin with multifactorial etiology. It is characterized by red, scaly plaques usually found on the scalp, elbows and knees. These lesions are caused by abnormal keratinocyte proliferation and infiltration of inflammatory cells into the dermis and epidermis.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 2 fibronectin type-III domains.
  • Post-translational
    modifications

    Phosphorylated in response to IL23.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • IL 23R antibody
    • IL-23 receptor antibody
    • IL-23R antibody
    • IL23 Receptor antibody
    • Il23r antibody
    • IL23R_HUMAN antibody
    • Interleukin 23 receptor antibody
    • Interleukin-23 receptor antibody
    see all

Images

  • All lanes : Anti-IL-23R antibody [ABM25G4] (ab228426) at 1 µg/ml

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) cell lysate
    Lane 2 : THP-1 (human monocytic leukemia cell line) cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) cell lysate

    Predicted band size: 72 kDa

References

ab228426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab228426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up