Overview

  • Product name

    Anti-IL-28A antibody [7B9A4]
    See all IL-28A primary antibodies
  • Description

    Mouse monoclonal [7B9A4] to IL-28A
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IL-28A aa 1-200. (Expressed in E.coli).
    Sequence:

    MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLS PQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEA ELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPR TRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV


    Database link: Q8IZJ0

  • Positive control

    • WB: SK-BR-3 cell lysate; Recombinant human IL28A protein; IL28A (AA: 1-200)-hIgGFc transfected HEK-293 cell lysate. IHC-P: Human brain and esophageal cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/200 - 1/1000.

Target

  • Function

    Cytokine with immunomodulatory activity. Up-regulates MHC class I antigen expression. Displays potent antiviral activity. Also displays antitumor activity. Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.
  • Sequence similarities

    Belongs to the IL-28/IL-29 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytokine ZCYTO20 antibody
    • IFN-lambda-2 antibody
    • IFNL2 antibody
    • IL-28A antibody
    • IL28A antibody
    • IL28A_HUMAN antibody
    • Interferon lambda 2 antibody
    • Interferon lambda-2 antibody
    • interleukin 28A (interferon, lambda 2) antibody
    • Interleukin 28A antibody
    • Interleukin-28A antibody
    • ZCYTO20 antibody
    see all

Images

  • Paraffin-embedded human esophageal cancer tissue stained for IL28A using ab233761 at 1/200 dilution in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human brain tissue stained for IL28A using ab233761 at 1/200 dilution in immunohistochemical analysis. DAB staining.

  • Anti-IL-28A antibody [7B9A4] (ab233761) at 1/500 dilution + SK-BR-3 (Human mammary gland adenocarcinoma cell line) cell lysate
  • All lanes : Anti-IL-28A antibody [7B9A4] (ab233761) at 1/500 dilution

    Lane 1 : HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : IL28A (AA: 1-200)-hIgGFc transfected HEK-293 cell lysate.
  • Anti-IL-28A antibody [7B9A4] (ab233761) at 1/500 dilution + IL28A (AA: 1-200) recombinant protein

References

ab233761 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233761.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up