Overview

  • Product name

  • Description

    Mouse polyclonal to IL-2RG
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human IL-2RG aa 1-369.
    Sequence:

    MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSL SVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQ KCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQN LVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQ SVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNT SKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASP CNQHSPYWAPPCYTLKPET


    Database link: NP_000197.1

  • Positive control

    • IL-2RG-transfected 293T cell lysate.
  • General notes

    Protein previously labeled as IL2 Receptor gamma.

Properties

Applications

Our Abpromise guarantee covers the use of ab172034 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa.

Target

  • Function

    Common subunit for the receptors for a variety of interleukins.
  • Involvement in disease

    Defects in IL2RG are the cause of severe combined immunodeficiency X-linked T-cell-negative/B-cell-positive/NK-cell-negative (XSCID) [MIM:300400]; also known as agammaglobulinemia Swiss type. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development.
    Defects in IL2RG are the cause of X-linked combined immunodeficiency (XCID) [MIM:312863]. XCID is a less severe form of X-linked immunodeficiency with a less severe degree of deficiency in cellular and humoral immunity than that seen in XSCID.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 5 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD132 antibody
    • CD132 antigen antibody
    • CIDX antibody
    • common cytokine receptor gamma chain antibody
    • Cytokine receptor common subunit gamma antibody
    • Gamma C antibody
    • gamma(c) antibody
    • gammaC antibody
    • IL-2 receptor subunit gamma antibody
    • IL-2R gamma chain antibody
    • IL-2R subunit gamma antibody
    • IL-2RG antibody
    • Il2rg antibody
    • IL2RG_HUMAN antibody
    • IMD4 antibody
    • interleukin 2 receptor, gamma antibody
    • Interleukin-2 receptor subunit gamma antibody
    • p64 antibody
    • SCIDX antibody
    • SCIDX1 antibody
    see all

Images

  • All lanes : Anti-IL-2RG antibody (ab172034) at 1 µg/ml

    Lane 1 : IL-2RG-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution

    Predicted band size: 42 kDa

References

ab172034 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172034.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up