Overview

  • Product name
    Anti-IL-36 gamma / IL-1F9 antibody [OTI2F4]
    See all IL-36 gamma / IL-1F9 primary antibodies
  • Description
    Mouse monoclonal [OTI2F4] to IL-36 gamma / IL-1F9
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IL-36 gamma/ IL-1F9 aa 1-169.
    Sequence:

    MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDS VTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLK EQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPII LTSELGKSYNTAFELNIND


    Database link: NP_062564

  • Positive control
    • HEK293T cells transfected with pCMV6-ENTRY IL36 gamma cDNA; Human colon adenocarcinoma and pancreas tissues; HeLa cells
  • General notes

    Dilute in PBS (pH7.3) before use.

    The clone number has been updated from 2F4 to OTI2F4, both clone numbers name the same clone.

    This product was changed from ascites to tissue culture supernatant on 29th May 2018. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

    Previously labelled as IL36 gamma. 

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 48% PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    ab156783 is purified from TCS by affinity chromatography
  • Clonality
    Monoclonal
  • Clone number
    OTI2F4
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab156783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/4000. Predicted molecular weight: 19 kDa.
IHC-P 1/150.

Perform heat-induced epitope retrieval with 10mM citric buffer, pH 6.0 at 120oC for 3 minutes.

ICC/IF 1/100.

Target

  • Function
    Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2. Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response.
  • Tissue specificity
    Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin.
  • Sequence similarities
    Belongs to the IL-1 family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • IL 1 epsilon antibody
    • IL 1 related protein 2 antibody
    • IL 1(EPSILON) antibody
    • IL 1F9 antibody
    • IL 1H1 antibody
    • IL 1RP2 antibody
    • IL-1 epsilon antibody
    • IL-1-related protein 2 antibody
    • IL-1F9 antibody
    • IL-1H1 antibody
    • IL-1RP2 antibody
    • IL1E antibody
    • Il1f9 antibody
    • IL1F9_HUMAN antibody
    • IL1H1 antibody
    • IL1RP2 antibody
    • IL36 gamma antibody
    • IL36G antibody
    • Interleukin 1 epsilon antibody
    • Interleukin 1 family member 9 antibody
    • Interleukin 1 homolog 1 antibody
    • Interleukin 1 related protein 2 antibody
    • Interleukin 36 gamma antibody
    • Interleukin-1 epsilon antibody
    • Interleukin-1 family member 9 antibody
    • Interleukin-1 homolog 1 antibody
    see all

Images

  • All lanes : Anti-IL-36 gamma / IL-1F9 antibody [OTI2F4] (ab156783) at 1/4000 dilution

    Lane 1 : HEK293T cells transfected with pCMV6-ENTRY control

    Lane 2 : HEK293T cells transfected with pCMV6-ENTRY IL36 gamma cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 19 kDa



    HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC213525)
  • Immunohistochemical analysis of paraffin-embedded Human colon adenocarcinoma tissue labeling IL36 gamma / IL-1F9 with ab156783 at 1/150 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling IL36 gamma / IL-1F9 with ab156783 at 1/150 dilution

  • Immunofluorescent analysis of HeLa cells labeling IL36 gamma / IL-1F9 using ab156783 at 1/100 dilution.

References

This product has been referenced in:
See all 2 Publications for this product

Customer reviews and Q&As

Answer

I have been in contact with the lab regarding ab156783.

ab156783 is raised against a full length human recombinant protein of human IL1F9(NP_062564) produced in HEK293T cell and unfortunately, we haven't done epitope mapping, so we are not sure where the antibody binds to human IL1F9 protein.

We also have never tested the cross-reactivity of this antibody to other IL-36 family members (IL-36a, IL-36b, IL-36Ra).

I have tried to look at the available literature for this clone to see whether this testing has been done elsewhere but unfortunately was unsuccessful in finding any additional information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up