Overview

  • Product name

    Anti-IL-36R antibody [ABM47A2] - N-terminal
    See all IL-36R primary antibodies
  • Description

    Mouse monoclonal [ABM47A2] to IL-36R - N-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human IL-36R aa 1-203 (N terminal).
    Sequence:

    MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSG EVSVTWYKNSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGR DSCHRIHVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDSLTCHLHF PKSCVLGPIKWYKDCNEIKGERFTVLETRLLVSNVSAEDRGNYACQAILT HSG


    Database link: Q9HB29

  • Positive control

    • Human small intestine lysate.
  • General notes

     This product was previously labelled as IL-1RL2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 99% PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    ABM47A2
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab210933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function

    Receptor for interleukin 1 family member 9 (IL1F9). Binding to the agonist leads to the activation of NF-kappa-B.
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • IL 1 receptor related protein 2 antibody
    • IL 1Rrp2 antibody
    • IL 36R antibody
    • IL-1Rrp2 antibody
    • IL-36 receptor antibody
    • IL1 receptor related protein 2 antibody
    • IL1R rp2 antibody
    • IL1R-rp2 antibody
    • Il1rl2 antibody
    • IL1RRP2 antibody
    • IL36R antibody
    • ILRL2_HUMAN antibody
    • Interleukin 1 receptor like 2 antibody
    • Interleukin 1 receptor related protein 2 antibody
    • Interleukin-1 receptor-like 2 antibody
    • Interleukin-1 receptor-related protein 2 antibody
    see all

Images

  • Anti-IL-36R antibody [ABM47A2] - N-terminal (ab210933) at 2 µg/ml + human small intestine lysate

    Predicted band size: 65 kDa

References

ab210933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab210933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up