Overview

  • Product name

    Anti-IL-36RN antibody - N-terminal
    See all IL-36RN primary antibodies
  • Description

    Rabbit polyclonal to IL-36RN - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human IL-36RN aa 1-92 (N terminal).
    Sequence:

    MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWL DASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGA


    Database link: Q9UBH0

  • Positive control

    • IHC-P: Human skin tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to interleukin 1 family member 9 (IL1F9). Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response.
  • Tissue specificity

    Predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.
  • Involvement in disease

    Defects in IL36RN are the cause of psoriasis generalized pustular (PSORP) [MIM:614204]. PSORP is a life-threatening disease defined by repeated flares of sudden onset consisting of diffuse erythematous skin eruption characterized by rapid coverage with pustules, high-grade fever, asthenia, marked leukocytosis, and elevated serum levels of C-reactive protein.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI413231 antibody
    • Family of interleukin 1 delta antibody
    • FIL1 antibody
    • FIL1 delta antibody
    • FIL1(DELTA) antibody
    • FIL1D antibody
    • Fil1delta antibody
    • I36RA_HUMAN antibody
    • IL 1 delta antibody
    • IL 1 related protein 3 antibody
    • IL 1F5 (IL 1HY1, FIL1 delta, IL 1RP3, IL 1L1, IL 1 delta) antibody
    • Il 1h3 antibody
    • IL 1HY1 antibody
    • IL 1L1 antibody
    • IL 1ra homolog antibody
    • IL 1ra homolog; IL1F5 (Canonical product IL 1F5a) antibody
    • IL 1RP3 antibody
    • IL-1 delta antibody
    • IL-1-related protein 3 antibody
    • IL-1F5 antibody
    • IL-1HY1 antibody
    • IL-1L1 antibody
    • IL-1ra homolog 1 antibody
    • IL-1RP3 antibody
    • IL1F5 antibody
    • IL1HY1 antibody
    • IL1L1 antibody
    • IL1RP3 antibody
    • IL36RA antibody
    • IL36RN antibody
    • Interleukin 1 delta antibody
    • Interleukin 1 family member 5 (delta) antibody
    • Interleukin 1 family member 5 antibody
    • Interleukin 1 HY1 antibody
    • Interleukin 1 like protein 1 antibody
    • Interleukin 1 receptor antagonist homolog 1 antibody
    • Interleukin 36 receptor antagonist antibody
    • Interleukin-1 delta antibody
    • Interleukin-1 family member 5 antibody
    • Interleukin-1 HY1 antibody
    • Interleukin-1 receptor antagonist homolog 1 antibody
    • Interleukin-1-like protein 1 antibody
    • Interleukin-36 receptor antagonist protein antibody
    • MGC29840 antibody
    • PSORP antibody
    • RP23-176J12.6 antibody
    see all

Images

  • Paraffin-embedded human skin tissue stained for IL36RN using ab224489 at 1/500 dilution in immunohistochemical analysis.

References

ab224489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up