Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-4I1/LAO
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human IL-4I1/LAO aa 486-535 (C terminal).
    Sequence:

    PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS

  • Positive control

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab133833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa.

Target

  • Relevance

    IL-4-induced gene-1 (Il-4i1 or Fig1) is expressed in primarily immune tissues and genetically maps to a region of susceptibility to autoimmune disease. The predicted Il-4i1 protein (IL-4I1) sequence is most similar to apoptosis-inducing protein and Apoxin I, which are both l-amino acid oxidases.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • FIG 1 antibody
    • Fig 1 protein antibody
    • FIG1 antibody
    • Fig1 protein antibody
    • HCG2043070 antibody
    • hFIG 1 antibody
    • hFIG1 antibody
    • IL4 induced protein 1 antibody
    • IL4I1 antibody
    • Interleukin 4 induced 1 antibody
    • Interleukin 4 induced protein 1 antibody
    • Interleukin four induced 1 antibody
    • L amino acid oxidase antibody
    • LAAO antibody
    • LAO antibody
    • Protein Fig 1 antibody
    • Protein Fig1 antibody
    see all

Images

  • Anti-IL-4I1/LAO antibody (ab133833) at 1 µg/ml + HeLa cell lysate at 10 µg

    Predicted band size: 63 kDa

References

ab133833 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133833.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up