Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-4R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human IL-4R aa 200-232 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH


    Database link: P24394

  • Positive control

    • Human colon carcinoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA

    Aqueous buffered solution
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 90 kDa.
Flow Cyt 1/20 - 1/100.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

Target

  • Function

    Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammmation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
    Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells.
  • Tissue specificity

    Isoform 1 and isoform 2 are highly expressed in activated T-cells.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain

    The extracellular domain represents the IL4 binding protein (IL4BP).
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications

    On IL4 binding, phosphorylated on C-terminal tyrosine residues. Phosphorylation on any one of tyrosine residues, Tyr-575, Tyr-603 or Tyr-631, is required for STAT6-induced gene induction.
    The soluble form (sIL4R/IL4BP) can also be produced by proteolytic cleavage at the cell surface (shedding) by a metalloproteinase.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD124 antibody
    • IL 4R alpha antibody
    • IL-4 receptor subunit alpha antibody
    • IL-4-binding protein antibody
    • IL-4R subunit alpha antibody
    • IL-4R-alpha antibody
    • IL-4RA antibody
    • IL4-BP antibody
    • Il4r antibody
    • IL4R nirs variant 1 antibody
    • IL4RA antibody
    • IL4RA_HUMAN antibody
    • Interleukin 4 receptor alpha chain antibody
    • Interleukin 4 receptor antibody
    • sIL4Ralpha/prot antibody
    • Soluble IL-4 receptor subunit alpha antibody
    • Soluble IL-4R-alpha antibody
    • Soluble interleukin-4 receptor subunit alpha antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling IL4R with ab203398 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Formalin-fixed, paraffin-embedded human colon carcinoma tissue stained for IL4R using ab203398 at 1/200 dilution in immunohistochemical analysis, followed by conjugation to the secondary antibody Goat Anti-Rabbit IgG, AF488 conjugated at 1/200 dilution.

References

ab203398 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203398.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up