Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein corresponding to Mouse IL-6 aa 25-211. Mature protein produced in E.coli. (NP_112445.1).
    Sequence:

    FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNS DCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYL EYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALL TDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT


    Database link: P08505

  • Positive control

    • WB: Recombinant mature mouse IL6 protein. IHC-P: Mouse pancreas.

Properties

Applications

Our Abpromise guarantee covers the use of ab208113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 23 kDa.
ELISA 1/10000.
IHC-P 1/50. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function

    Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.
  • Involvement in disease

    Genetic variations in IL6 are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ) [MIM:604302]. An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.
    Note=A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men.
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Interleukin BSF 2 antibody
    • B cell differentiation factor antibody
    • B cell stimulatory factor 2 antibody
    • B-cell stimulatory factor 2 antibody
    • BSF 2 antibody
    • BSF-2 antibody
    • BSF2 antibody
    • CDF antibody
    • CTL differentiation factor antibody
    • Cytotoxic T cell differentiation factor antibody
    • Hepatocyte stimulating factor antibody
    • Hepatocyte stimulatory factor antibody
    • HGF antibody
    • HSF antibody
    • Hybridoma growth factor antibody
    • Hybridoma growth factor Interferon beta-2 antibody
    • Hybridoma plasmacytoma growth factor antibody
    • IFN-beta-2 antibody
    • IFNB2 antibody
    • IL 6 antibody
    • IL-6 antibody
    • IL6 antibody
    • IL6_HUMAN antibody
    • Interferon beta 2 antibody
    • Interferon beta-2 antibody
    • Interleukin 6 antibody
    • Interleukin 6 (interferon beta 2) antibody
    • Interleukin BSF 2 antibody
    • Interleukin-6 antibody
    see all

Images

  • Anti-IL-6 antibody (ab208113) at 1/1000 dilution + recombinant mature mouse IL6 protein at 0.1 µg

    Secondary
    anti-Rabbit IgG (H&L) (Goat) Dylight™ 649 Conjugate at 1/20000 dilution

    Predicted band size: 23 kDa

  • Immunohistochemistry with ab208113 showing nuclear positivity of islets of Langerhans (brown staining) and cytoplasmic staining in mouse pancreas at 10x and 20x (B and C). Staining was performed on Leica Bond system using the standard protocol. Formalin fixed/paraffin embedded tissue sections were subjected to antigen retrieval with E1 (Leica Microsystems) retrieval solution for 20 minutes and then incubated with ab208113 at 1/50 dilution for 60 minutes. Biotinylated Anti-rabbit secondary antibody was used at 1/200 dilution to detect primary antibody. The reaction was developed using streptavidin-HRP conjugated compact polymer system and visualized with chromogen substrate, 3’3-diamino-benzidine substrate (DAB). The sections were then counterstained with hematoxylin to detect cell nuclei.

    Negative control: primary antibody was omitted (A).

  • Immunohistochemistry with ab208113 showing cytoplasmic IL-6 staining in mouse pancreas exocrine and endocrine sections with islets of Langerhans at 10x and 20x (bottom left and bottom right). Staining was performed on Leica Bond system using the standard protocol. Formalin fixed/paraffin embedded tissue sections were subjected to antigen retrieval with E1 (Leica Microsystems) retrieval solution for 20 minutes and then incubated with ab208113 at 1/50 dilution for 60 minutes. Biotinylated Anti-rabbit secondary antibody was used at 1/200 dilution to detect primary antibody. The reaction was developed using streptavidin-HRP conjugated compact polymer system and visualized with chromogen substrate, 3’3-diamino-benzidine substrate (DAB). The sections were then counterstained with hematoxylin to detect cell nuclei.

    Negative control: primary antibody was omitted (top).

References

This product has been referenced in:

  • Liu G  et al. Long non-coding RNA THRIL promotes LPS-induced inflammatory injury by down-regulating microRNA-125b in ATDC5 cells. Int Immunopharmacol 66:354-361 (2019). Read more (PubMed: 30521964) »
  • Pan G  et al. Regulation of lipoprotein-associated phospholipase A2 silencing on myocardial fibrosis in mice with coronary atherosclerosis. Biochem Biophys Res Commun 514:450-455 (2019). Read more (PubMed: 31053299) »
See all 10 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Bone marrow)
Permeabilization
Yes - 0.05% TX-100
Specification
Bone marrow
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jan 01 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Mesenchyma tumor)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: TE pH9
Permeabilization
No
Specification
Mesenchyma tumor
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C
Fixative
10% normal formalin

Abcam user community

Verified customer

Submitted Dec 31 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Kidney)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: TE pH9
Permeabilization
No
Specification
Kidney
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C
Fixative
10% normal buffered formalin

Abcam user community

Verified customer

Submitted Dec 31 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up