Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Mouse IL-9 aa 20-60 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVP


    Database link: P15247

  • Positive control

    • Mouse lung and Human rheumatoid synovial tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

WB Use at an assay dependent concentration. Predicted molecular weight: 15 kDa.

Target

  • Function

    Supports IL-2 independent and IL-4 independent growth of helper T-cells.
  • Sequence similarities

    Belongs to the IL-7/IL-9 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytokine P40 antibody
    • Homolog of mouse T cell and mast cell growth factor 40 antibody
    • HP40 antibody
    • IL 9 antibody
    • IL-9 antibody
    • Il9 antibody
    • IL9_HUMAN antibody
    • Interleukin 9 antibody
    • Interleukin-9 antibody
    • Mast cell growth factor antibody
    • MCGF antibody
    • Megakaryoblast growth factor antibody
    • P40 antibody
    • p40 cytokine antibody
    • p40 T cell and mast cell growth factor antibody
    • T cell growth factor 3 antibody
    • T cell growth factor p40 antibody
    • T-cell growth factor P40 antibody
    • TCGF 3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse lung tissue labeling IL9 with ab203386 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Anti-IL-9 antibody (ab203386) at 1/300 dilution + Mouse lung tissue lysate

    Predicted band size: 15 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up