Overview

  • Product name

    Anti-IL2 Receptor beta/p75 antibody [1G11C6]
    See all IL2 Receptor beta/p75 primary antibodies
  • Description

    Mouse monoclonal [1G11C6] to IL2 Receptor beta/p75
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human IL2 Receptor beta/p75 aa 27-240. Expressed in E.coli.
    Sequence:

    AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCEL LPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKP FENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGH TWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQP LAFRTKPAALGKDT


    Database link: P14784

  • Positive control

    • WB: Recombinant human IL2 Receptor beta/p75 (aa 27-240) protein; IL2 Receptor beta/p75 (aa 27-240)-hIgG-Fc-transfected HEK-293 cell lysate. Flow cyt: HL-60 and Jurkat cells.
  • General notes

     This product was previously labelled as IL2 Receptor beta

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD122 antibody
    • CD122 antigen antibody
    • High affinity IL 2 receptor beta subunit antibody
    • High affinity IL 2 receptor subunit beta antibody
    • High affinity IL-2 receptor subunit beta antibody
    • IL-2 receptor subunit beta antibody
    • IL-2R subunit beta antibody
    • IL-2RB antibody
    • IL15RB antibody
    • IL2 receptor antibody
    • IL2RB antibody
    • IL2RB_HUMAN antibody
    • Interleukin 2 receptor beta antibody
    • Interleukin-2 receptor subunit beta antibody
    • P70 75 antibody
    • P70-75 antibody
    • P7075 antibody
    • p75 antibody
    see all

Images

  • Anti-IL2 Receptor beta/p75 antibody [1G11C6] (ab233792) at 1/500 dilution + Recombinant human IL2 Receptor beta/p75 (aa 27-240) protein


    Expected MW is 51kDa.

  • All lanes : Anti-IL2 Receptor beta/p75 antibody [1G11C6] (ab233792) at 1/500 dilution

    Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : IL2 Receptor beta/p75 (aa 27-240)-hIgG-Fc-transfected HEK-293 cell lysate
  • Flow cytometric analysis of HL-60 (human promyelocytic leukemia cell line) cells labeling IL2 Receptor beta/p75 with ab233792 at 1/200 dilution (green) compared with a negative control (red).

  • Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells labeling IL2 Receptor beta/p75 with ab233792 at 1/200 dilution (green) compared with a negative control (red).

References

ab233792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up