Overview

  • Product name

    Anti-IL22 RA2/IL-22BP antibody
    See all IL22 RA2/IL-22BP primary antibodies
  • Description

    Rabbit polyclonal to IL22 RA2/IL-22BP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human IL22 RA2/IL-22BP aa 195-230 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    IEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEA


    Database link: Q969J5

  • Positive control

    • Human breast carcinoma and rat lung tissues; Mouse brain tissue, spleen tissue lysate and splenocytes.
  • General notes

    Protein previously labeled as IL22 RA2.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA

    Aqueous buffered solution.
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/20 - 1/100.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/50 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

WB 1/100 - 1/1000. Predicted molecular weight: 31 kDa.

Target

  • Function

    Isoform 2 is a receptor for IL22. Binds to IL22, prevents interaction with the functional IL-22R complex and blocks the activity of IL22 (in vitro). May play an important role as an IL22 antagonist in the regulation of inflammatory responses.
    Isoform 1 may play a role in establishing and maintaining successful pregnancy.
  • Tissue specificity

    Expressed in placenta, spleen, breast, skin and lung. Also detected in intestinal tract, testis, brain, heart and thymus. No expression found in prostate, bladder, kidney, ovary, muscle, bone marrow, liver and uterus. Isoform 1 is expressed only in placenta. Isoform 2 is expressed in placenta and breast and at lower level in spleen, skin, thymus and stomach.
  • Sequence similarities

    Belongs to the type II cytokine receptor family.
    Contains 3 fibronectin type-III domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • IL 22BP antibody
    • IL 22RA2 antibody
    • IL22RA2 antibody
    • Class II cytokine receptor antibody
    • CRF2 10 antibody
    • CRF2 S1 antibody
    • CRF2-10 antibody
    • CRF2-S1 antibody
    • CRF2X antibody
    • Cytokine receptor class II member 10 antibody
    • Cytokine receptor class-II member 10 antibody
    • Cytokine receptor family 2 member 10 antibody
    • Cytokine receptor family type 2 antibody
    • Cytokine receptor family type 2 soluble 1 antibody
    • I22R2_HUMAN antibody
    • IL 22 receptor subunit alpha 2 antibody
    • IL 22R alpha 2 antibody
    • IL-22 receptor subunit alpha-2 antibody
    • IL-22BP antibody
    • IL-22R-alpha-2 antibody
    • IL-22RA2 antibody
    • IL22 RA2 antibody
    • IL22BP antibody
    • IL22R alpha 2 antibody
    • Il22ra2 antibody
    • Interleukin 22 binding protein antibody
    • Interleukin 22 Receptor alpha 2 antibody
    • Interleukin-22 receptor subunit alpha-2 antibody
    • Interleukin-22-binding protein antibody
    • MGC150509 antibody
    • MGC150510 antibody
    • soluble 1 antibody
    • ZcytoR16 antibody
    see all

Images

  • Anti-IL22 RA2/IL-22BP antibody (ab203211) at 1/300 dilution + Mouse spleen tissue lysates

    Secondary
    Conjugated secondary antibody at 1/10000 dilution

    Predicted band size: 31 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human breast carcinoma tissue labeling IL22 RA2 / IL-22BP with ab203211 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse brain tissue labeling IL22 RA2 / IL-22BP with ab203211 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat lung tissue labeling IL22 RA2 / IL-22BP with ab203211 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Flow Cytometry analysis of Mouse splenocytes labeling IL22 RA2 / IL-22BP with ab203211 at 1/100, followed by incubation with a PE conjugated secondary antibody (green). Blue represents control cells, secondary only control in shown in light blue and isotype control in orange. 

References

This product has been referenced in:

  • Zheng Y  et al. IL-22/IL-22R1 axis is involved in myocardial injury of a mouse cecal ligation and puncture model. Am J Transl Res 11:998-1008 (2019). Read more (PubMed: 30899399) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up