Overview

  • Product name

    Anti-IL36 gamma/IL-1F9 antibody [D2]
    See all IL36 gamma/IL-1F9 primary antibodies
  • Description

    Mouse monoclonal [D2] to IL36 gamma/IL-1F9
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse IL36 gamma/IL-1F9 aa 5-149. N-terminal tag (Expressed in E.coli).
    Sequence:

    HPFSTHISGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTIL PCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYH HPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSK


    Database link: Q8R460

  • Positive control

    • IHC-P: Mouse colon, kidney, intestine, lung and liver tissues. WB: Rat serum; Recombinant mouse IL36 gamma/IL-1F9 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    D2
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 19 kDa.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Function

    Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2. Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response.
  • Tissue specificity

    Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • IL 1 epsilon antibody
    • IL 1 related protein 2 antibody
    • IL 1(EPSILON) antibody
    • IL 1F9 antibody
    • IL 1H1 antibody
    • IL 1RP2 antibody
    • IL-1 epsilon antibody
    • IL-1-related protein 2 antibody
    • IL-1F9 antibody
    • IL-1H1 antibody
    • IL-1RP2 antibody
    • IL1E antibody
    • Il1f9 antibody
    • IL1F9_HUMAN antibody
    • IL1H1 antibody
    • IL1RP2 antibody
    • IL36 gamma antibody
    • IL36G antibody
    • Interleukin 1 epsilon antibody
    • Interleukin 1 family member 9 antibody
    • Interleukin 1 homolog 1 antibody
    • Interleukin 1 related protein 2 antibody
    • Interleukin 36 gamma antibody
    • Interleukin-1 epsilon antibody
    • Interleukin-1 family member 9 antibody
    • Interleukin-1 homolog 1 antibody
    see all

Images

  • Paraffin-embedded mouse colon tissue stained for IL36 gamma/IL-1F9 using ab239526 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-IL36 gamma/IL-1F9 antibody [D2] (ab239526) at 3 µg/ml + Rat serum

    Predicted band size: 19 kDa

  • Paraffin-embedded mouse intestine tissue stained for IL36 gamma/IL-1F9 using ab239526 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse lung tissue stained for IL36 gamma/IL-1F9 using ab239526 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse liver tissue stained for IL36 gamma/IL-1F9 using ab239526 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse kidney tissue stained for IL36 gamma/IL-1F9 using ab239526 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-IL36 gamma/IL-1F9 antibody [D2] (ab239526) at 5 µg/ml + Recombinant mouse IL36 gamma/IL-1F9 protein

    Predicted band size: 19 kDa

References

ab239526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239526.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up