Overview

  • Product name

  • Description

    Rabbit polyclonal to IL3RA/CD123
  • Host species

    Rabbit
  • Specificity

    ab200687 detects endogenous levels of IL3RA / CD123 protein.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human IL3RA/CD123 aa 271-316 (C terminal).
    Sequence:

    QIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLL


    Database link: P26951

  • Positive control

    • MCF7, NIH3T3 and PC12 whole cell lysates.
  • General notes

    Previously labelled as IL3RA. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.0975% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    purified by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab200687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration.

Target

  • Function

    This is a receptor for interleukin-3.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 5 subfamily.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD123 antibody
    • CD123 antigen antibody
    • hIL 3Ra antibody
    • hIL-3Ra antibody
    • hIL3Ra antibody
    • IL 3 receptor alpha SP2 isoform antibody
    • IL 3R alpha antibody
    • IL-3 receptor subunit alpha antibody
    • IL-3R subunit alpha antibody
    • IL-3R-alpha antibody
    • IL-3RA antibody
    • IL3 Receptor alpha antibody
    • IL3R antibody
    • Il3ra antibody
    • IL3RA_HUMAN antibody
    • IL3RAX antibody
    • IL3RAY antibody
    • IL3RX antibody
    • IL3RY antibody
    • Interleukin 3 receptor alpha chain antibody
    • Interleukin 3 receptor, alpha (low affinity) antibody
    • Interleukin 3 receptor, alpha antibody
    • Interleukin-3 Receptor alpha antibody
    • Interleukin-3 receptor subunit alpha antibody
    • Interleukin3 receptor antibody
    • Interleukin3 receptor, Y-chromosomal antibody
    see all

Images

  • All lanes : Anti-IL3RA/CD123 antibody (ab200687)

    Lane 1 : MCF7 whole cell lysate
    Lane 2 : NIH3T3 whole cell lysate
    Lane 3 : PC12 whole cell lysate

References

ab200687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up