Biotin Anti-IL-4 antibody (ab84242)
Key features and details
- Biotin Rabbit polyclonal to IL-4
- Suitable for: WB
- Reacts with: Recombinant fragment
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-IL-4 antibody
See all IL-4 primary antibodies -
Description
Biotin Rabbit polyclonal to IL-4 -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human IL-4.
Sequence:MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAA TVLRQFYSHHEKDTRCLGATAQQFHRHKQLRFLKRLDRNLWGLAGLNSCP VKEANQSTLENFLERLKTIMREKYSKCSS
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute in sterile PBS containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: PBS -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
ab84242 was purified by affinity chromatography and then biotinylated and filter sterilised. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab84242 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 17 kDa.
The detection limit for recombinant hIL-4 is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions. |
Notes |
---|
WB
Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 17 kDa. The detection limit for recombinant hIL-4 is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions. |
Target
-
Function
Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. -
Involvement in disease
Genetic variations in IL4 may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. -
Sequence similarities
Belongs to the IL-4/IL-13 family. -
Cellular localization
Secreted. - Information by UniProt
-
Alternative names
- B cell growth factor 1 antibody
- B cell IgG differentiation factor antibody
- B Cell Stimulatory Factor 1 antibody
see all
Images
-
To detect human IL-4 by Western Blot analysis ab84242 can be used at a concentration of 0.1 - 0.2 µg/ml. Used in conjunction with compatible secondary reagents the detection limit for recombinant human IL-4 is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.
Image shown is non-reducing conditions; Human recombinant IL-4 protein at 250 - 0.24 ng/ml.
Lane 1 is MW marker, lanes 2-12 human recombinant IL-4 protein.
Datasheets and documents
-
Datasheet download
References (0)
ab84242 has not yet been referenced specifically in any publications.