Overview

  • Product name
  • Description
    Rabbit polyclonal to ILF3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Zebrafish
  • Immunogen

    Synthetic peptide within Human ILF3 aa 6-55 (N terminal). The exact sequence is proprietary.
    Sequence:

    IFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKG


    Database link: Q12906

  • Positive control
    • K562 cell lysate and human lung tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab50832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.25 µg/ml. Detects a band of approximately 70 kDa (predicted molecular weight: 95 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function
    May facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. Can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. Can regulate protein arginine N-methyltransferase 1 activity. May regulate transcription of the IL2 gene during T-cell activation. Can promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 2 DRBM (double-stranded RNA-binding) domains.
    Contains 1 DZF domain.
  • Post-translational
    modifications
    Phosphorylated by RNA-dependent protein kinase (EIF2AK2).
    Methylated by protein arginine N-methyltransferase 1.
    Arg-609 is dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization
    Nucleus > nucleolus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt
  • Database links
  • Alternative names
    • CBTF antibody
    • Double stranded RNA binding protein 76 antibody
    • Double-stranded RNA-binding protein 76 antibody
    • DRBF antibody
    • DRBP76 antibody
    • ILF3 antibody
    • ILF3_HUMAN antibody
    • Interleukin enhancer binding factor 3 antibody
    • Interleukin enhancer-binding factor 3 antibody
    • M phase phosphoprotein 4 antibody
    • M-phase phosphoprotein 4 antibody
    • MPHOSPH4 antibody
    • MPP4 antibody
    • NF AT 90 antibody
    • NF-AT-90 antibody
    • NF110 antibody
    • NF90 antibody
    • NFAR antibody
    • Nuclear factor associated with dsRNA antibody
    • Nuclear factor of activated T cells 90 kDa antibody
    • Nuclear factor of activated T-cells 90 kDa antibody
    • TCP80 antibody
    • Translational control protein 80 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pineal tissue labelling ILF3 with ab50832 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as teh secondary antibody. Positive staining shown in the cytoplasm and nuclei of pinealocytes. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - ILF3. Right - Merge.
  • Anti-ILF3 antibody (ab50832) at 0.25 µg/ml + K562 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG (1/ 50,000 - 100,000)

    Predicted band size: 95 kDa
    Observed band size: 70 kDa
    why is the actual band size different from the predicted?



    The primary antibody was diluted in 5% skim milk/PBS buffer.
  • Ab50832 (8ug/ml) staining human ILF3 in human lung tissue by immunohistochemistry using paraffin embedded tissue. Positively labelled cells, alveolar cells, are indicated with arrows.

References

This product has been referenced in:
  • Ottolini D  et al. The Parkinson disease-related protein DJ-1 counteracts mitochondrial impairment induced by the tumour suppressor protein p53 by enhancing endoplasmic reticulum-mitochondria tethering. Hum Mol Genet N/A:N/A (2013). WB ; Human . Read more (PubMed: 23418303) »
  • Calì T  et al. Enhanced parkin levels favor ER-mitochondria crosstalk and guarantee Ca(2+) transfer to sustain cell bioenergetics. Biochim Biophys Acta 1832:495-508 (2013). WB . Read more (PubMed: 23313576) »
See all 3 Publications for this product

Customer reviews and Q&As

Answer

DISCOUNT CODE: xxxxxxxxxx Expiration date: 19-01-2012 I am very pleased to hear you would like to accept our offer and test ab50832 in Xenopus leavis. This code will give you 1 free PRIMARY ANTIBODY before the expiration date. To redeem this offer, please submit an Abreview for ab50832 and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code. Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research. The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up