Overview

  • Product name

  • Description

    Rabbit polyclonal to ILT-3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ILT-3 aa 22-259. Extracellular domain.
    Sequence:

    QAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRLDKEESPAPWDR QNPLEPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGAY SKPTLSALPSPLVTSGKSVTLLCQSRSPMDTFLLIKERAAHPLLHLRSEH GAQQHQAEFPMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVSGSL EDPRPSPTRSVSTAAGPEDQPLMPTGSVPHSGLRRHWE


    Database link: Q8NHJ6

  • Positive control

    • WB: MCF7 and A549 whole cell lysates. IHC-P: Human lung tissue.
  • General notes

    Previously labelled as LILRB4.

Properties

Applications

Our Abpromise guarantee covers the use of ab229747 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 49 kDa (predicted molecular weight: 49 kDa).

Target

  • Function

    Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles. Involved in the down-regulation of the immune response and the development of tolerance, e.g. towards transplants. Interferes with TNFRSF5-signaling and NF-kappa-B up-regulation. Inhibits receptor-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions.
  • Tissue specificity

    Detected in monocytes, macrophages, dendritic cells, lung, natural killer cells and B-cells.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain

    Contains 3 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization

    Cell membrane. Ligand binding leads to internalization and translocation to an antigen-processing compartment.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD85 antigen-like family member K antibody
    • CD85k antibody
    • HM18 antibody
    • ILT-3 antibody
    • ILT3 antibody
    • Immunoglobulin-like transcript 3 antibody
    • Leukocyte immunoglobulin like receptor subfamily B (with TM and ITIM domains) member 4 antibody
    • Leukocyte immunoglobulin-like receptor 5 antibody
    • Leukocyte immunoglobulin-like receptor subfamily B member 4 antibody
    • LILRB4 antibody
    • LILRB5 antibody
    • LIR-5 antibody
    • LIR5 antibody
    • LIRB4_HUMAN antibody
    • Monocyte inhibitory receptor HM18 antibody
    see all

Images

  • All lanes : Anti-ILT-3 antibody (ab229747) at 1/1000 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 49 kDa
    Observed band size: 49 kDa

  • Paraffin-embedded human lung tissue stained for ILT-3 using ab229747 at 1/100 dilution in immunohistochemical analysis.

References

ab229747 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229747.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up