Overview

  • Product name

  • Description

    Rabbit polyclonal to IMMP2L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human IMMP2L aa 1-100.
    Sequence:

    MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNP GGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDI


    Database link: Q96T52

  • Positive control

    • IHC-P: Human melanoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMMPL1 and IMMPL2 are the catalytic subunits of the IMP complex.
  • Cellular localization

    Mitochondrion inner membrane; Single pass membrane protein.
  • Database links

  • Alternative names

    • EC 3.4.21 antibody
    • IMP2 antibody
    • IMP2 inner mitochondrial membrane peptidase like (S. cerevisiae) antibody
    • IMP2 inner mitochondrial membrane protease like (S. cerevisiae) antibody
    • IMP2 inner mitochondrial membrane protease like antibody
    • IMP2 like antibody
    • IMP2 like protein antibody
    • IMP2-LIKE antibody
    • Inner mitochondrial membrane peptidase 2 like antibody
    • Mitochondrial inner membrane protease subunit 2 antibody
    • OTTHUMP00000207168 antibody
    • OTTHUMP00000207189 antibody
    see all

Images

  • Paraffin-embedded human melanoma tissue stained for IMMP2L using ab234780 at 1/100 dilution in immunohistochemical analysis.

References

ab234780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up