Anti-IMP3 antibody (ab176685)
Key features and details
- Rabbit polyclonal to IMP3
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-IMP3 antibody
See all IMP3 primary antibodies -
Description
Rabbit polyclonal to IMP3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human IMP3 aa 1-50. The exact sequence is proprietary.
Sequence:MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDESWA
Database link: O00425 -
Positive control
- HeLa, Jurkat and 293T whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituent: 0.1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176685 was affinity purified using an epitope specific to IMP3 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab176685 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000 - 1/10000. Predicted molecular weight: 64 kDa. | |
IP | Use at 2-10 µg/mg of lysate. |
Target
-
Function
RNA-binding protein that act as a regulator of mRNA translation and stability. Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binds to sequences in the 3'-UTR of CD44 mRNA. -
Tissue specificity
Expressed in fetal liver, fetal lung, fetal kidney, fetal thymus, fetal placenta, fetal follicles of ovary and gonocytes of testis, growing oocytes, spermatogonia and semen (at protein level). Expressed in cervix adenocarcinoma, in testicular, pancreatic and renal-cell carcinomas (at protein level). Expressed ubiquitously during fetal development at 8 and 14 weeks of gestation. Expressed in ovary, testis, brain, placenta, pancreatic cancer tissues and pancreatic cancer cell lines. -
Sequence similarities
Belongs to the RRM IMP/VICKZ family.
Contains 4 KH domains.
Contains 2 RRM (RNA recognition motif) domains. -
Domain
The third and fourth KH domains are important for binding to the untranslated region (UTR) of target mRNA. -
Cellular localization
Nucleus. Cytoplasm. Found in lamellipodia of the leading edge, in the perinuclear region, and beneath the plasma membrane. The subcytoplasmic localization is cell specific and regulated by cell contact and growth. Localized at the connecting piece and the tail of the spermatozoa. Colocalized with CD44 mRNA in RNP granules. - Information by UniProt
-
Database links
- Entrez Gene: 10643 Human
- Omim: 608259 Human
- SwissProt: O00425 Human
- Unigene: 700696 Human
-
Alternative names
- Cancer/testis antigen 98 antibody
- CT98 antibody
- DKFZp686F1078 antibody
see all
Images
-
All lanes : Anti-IMP3 antibody (ab176685) at 0.04 µg/ml
Lane 1 : HeLa lysate at 50 µg
Lane 2 : HeLa lysate at 15 µg
Lane 3 : Jurkat lysate at 50 µg
Lane 4 : 293T lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 64 kDa
Exposure time: 3 minutes -
Detection of Human IMP3 by Western Blot of Immunoprecipitates.
Detection of IMP3 in Immunoprecipitates of HeLa whole cell lysates (1 mg for IP, 20% of IP loaded) using ab176685 at 6 µg/mg lysate for IP. For WB analysis of immunoprecipitated IMP3, ab176685 was used at 1 µg/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Protocols
Datasheets and documents
References (1)
ab176685 has been referenced in 1 publication.
- Wu C et al. Insulin-like growth factor II mRNA-binding protein 3 promotes cell proliferation, migration and invasion in human glioblastoma. Onco Targets Ther 12:3661-3670 (2019). PubMed: 31190868