Overview

  • Product name

  • Description

    Rabbit polyclonal to IMPACT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human IMPACT aa 41-320.
    Sequence:

    ISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLE EIYIQNIGESILYLWVEKIRDVLIQKSQMTEPGPDVKKKTEEEDVECEDD LILACQPESSLKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHL APVVCPKQVKMVLSKLYENKKIASATHNIYAYRIYCEDKQTFLQDCEDDG ETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILV EKNYTNSPEESSKALGKNKKVRKDKKRNEH


    Database link: Q9P2X3

  • Positive control

    • WB: HeLa and HL-60 whole cell lysates. IHC-P: Human endometrial cancer and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 36 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Translational regulator that ensures constant high levels of translation under amino acid starvation. Acts by interacting with GCN1/GCN1L1, thereby preventing activation of GCN2 protein kinases (EIF2AK1 to 4) and subsequent down-regulation of protein synthesis.
  • Tissue specificity

    Widely expressed. Expressed at high level in brain.
  • Sequence similarities

    Belongs to the IMPACT family.
    Contains 1 RWD domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • IMPACT antibody
    • Impact homolog (mouse) antibody
    • Impact homolog antibody
    • impact RWD domain protein antibody
    • IMPCT_HUMAN antibody
    • Imprinted and ancient gene protein homolog antibody
    • MGC33718 antibody
    • Protein IMPACT antibody
    • RWD domain containing 5 antibody
    • RWDD5 antibody
    see all

Images

  • All lanes : Anti-IMPACT antibody (ab235323) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 36 kDa

  • Paraffin-embedded human endometrial cancer tissue stained for IMPACT using ab235323 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for IMPACT using ab235323 at 1/100 dilution in immunohistochemical analysis.

References

ab235323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up