Overview

  • Product name

  • Description

    Rabbit polyclonal to Importin 8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Importin 8 aa 700-1000.
    Sequence:

    YVTIDTDTLLSNAKHLEILFTMCRKVLCGDAGEDAECHAAKLLEVIILQC KGRGIDQCIPLFVQLVLERLTRGVKTSELRTMCLQVAIAALYYNPDLLLH TLERIQLPHNPGPITVQFINQWMNDTDCFLGHHDRKMCIIGLSILLELQN RPPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENE EISSDEEETNVTAQAMQSNNGRGEDEEEEDDDWDEEVLEETALEGFSTPL DLDNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAE H


    Database link: O15397

  • Positive control

    • Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab208162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 120 kDa.

Target

  • Function

    Seems to function in nuclear protein import, either by acting as autonomous nuclear transport receptor or as an adapter-like protein in association with the importin-beta subunit KPNB1. Acting autonomously, is thought to serve itself as receptor for nuclear localization signals (NLS) and to promote translocation of import substrates through the nuclear pore complex (NPC) by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro mediates the nuclear import of SRP19.
  • Sequence similarities

    Belongs to the importin beta family.
    Contains 1 importin N-terminal domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ26580 antibody
    • Imp 8 antibody
    • Imp8 antibody
    • Importin-8 antibody
    • Importin8 antibody
    • IPO 8 antibody
    • IPO8 antibody
    • IPO8_HUMAN antibody
    • Ran binding protein 8 antibody
    • RAN BP8 antibody
    • Ran-binding protein 8 antibody
    • RANBP 8 antibody
    • RanBP8 antibody
    see all

Images

  • Anti-Importin 8 antibody (ab208162) at 2 µg/ml + Jurkat cell lysate

    Predicted band size: 120 kDa

References

ab208162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up