Overview

  • Product name
    Anti-Importin 9/RANBP9 antibody
    See all Importin 9/RANBP9 primary antibodies
  • Description
    Rabbit polyclonal to Importin 9/RANBP9
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Importin 9/RANBP9 aa 740-1041 (C terminal).
    Sequence:

    LWYVMQVVSQLLDPRTSEFTAAFVGRLVSTLISKAGRELGENLDQILRAI LSKMQQAETLSVMQSLIMVFAHLVHTQLEPLLEFLCSLPGPTGKPALEFV MAEWTSRQHLFYGQYEGKVSSVALCKLLQHGINADDKRLQDIRVKGEEIY SMDEGIRTRSKSAKNPERWTNIPLLVKILKLIINELSNVMEANAARQATP AEWSQDDSNDMWEDQEEEEEEEEDGLAGQLLSDILATSKYEEDYYEDDEE DDPDALKDPLYQIDLQAYLTDFLCQFAQQPCYIMFSGHLNDNERRVLQTI GI


    Database link: Q96P70

  • Positive control
    • 293 and 3T3 lysates.
  • General notes

     This product was previously labelled as Importin 9

     

Properties

Applications

Our Abpromise guarantee covers the use of ab208172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.25 µg/ml. Predicted molecular weight: 116 kDa.

Target

  • Function
    Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of H2B histone (By similarity), RPS7 and RPL18A. Prevents the cytoplasmic aggregation of RPS7 and RPL18A by shielding exposed basic domains. May also import H2A, H3, H4 histones (By similarity), RPL4 and RPL6.
  • Sequence similarities
    Belongs to the importin beta family.
    Contains 1 importin N-terminal domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Imp9 antibody
    • Imp9a antibody
    • Imp9b antibody
    • Importin-9 antibody
    • Importin-9a antibody
    • Ipo9 antibody
    • IPO9_HUMAN antibody
    • Ran-binding protein 9 antibody
    • RanBP9 antibody
    see all

Images

  • All lanes : Anti-Importin 9/RANBP9 antibody (ab208172) at 0.25 µg/ml

    Lane 1 : 293 lysate
    Lane 2 : 3T3 lysate

    Predicted band size: 116 kDa

References

ab208172 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up