Overview

  • Product name

  • Description

    Rabbit polyclonal to IMUP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human IMUP aa 1-52.
    Sequence:

    MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHH SS


    Database link: Q9GZP8

  • Positive control

    • PC3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Chromosome 19 open reading frame 33 antibody
    • H2RSP antibody
    • HAI 2 related small protein antibody
    • HAI-2-related small protein antibody
    • Hepatocyte growth factor activator inhibitor type 2 related small protein antibody
    • Hepatocyte growth factor activator inhibitor type 2-related small protein antibody
    • Immortalization up regulated protein antibody
    • Immortalization up-regulated protein antibody
    • Immortalization upregulated protein antibody
    • IMUP 1 antibody
    • IMUP 2 antibody
    • IMUP antibody
    • IMUP_HUMAN antibody
    • MGC39135 antibody
    • MGC75180 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized PC3 cells labeling IMUP with ab221063 at 4 µg/mL (green).

References

ab221063 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up