Anti-INF2 antibody (ab121114)
Key features and details
- Rabbit polyclonal to INF2
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-INF2 antibody
See all INF2 primary antibodies -
Description
Rabbit polyclonal to INF2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human INF2 aa 88-232.
Sequence:GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNV MVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNEL SG SDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR
Database link: Q27J81 -
Positive control
- IHC-P: INF2 transfected HEK293T cells, Human stomach tissue, U-251MG cells
-
General notes
This product was previously labelled as C14orf151
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab121114 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Use buffer at pH 6 for antigen retrieval. |
Target
-
Function
Severs actin filaments and accelerates their polymerization and depolymerization. -
Tissue specificity
Widely expressed. In the kidney, expression is apparent in podocytes and some tubule cells. -
Involvement in disease
Defects in INF2 are the cause of focal segmental glomerulosclerosis type 5 (FSGS5) [MIM:613237]. A renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and edema. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation. -
Sequence similarities
Belongs to the formin homology family.
Contains 1 FH2 (formin homology 2) domain.
Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
Contains 1 WH2 domain. -
Domain
The WH2 domain acts as the DAD (diaphanous autoregulatory) domain and binds to actin monomers.
Regulated by autoinhibition due to intramolecular GBD-DAD binding.
The severing activity is dependent on covalent attachment of the FH2 domain to the C-terminus. -
Cellular localization
Cytoplasm > perinuclear region. - Information by UniProt
-
Database links
- Entrez Gene: 64423 Human
- Omim: 610982 Human
- SwissProt: Q27J81 Human
- Unigene: 24956 Human
-
Alternative names
- C14orf151 antibody
- C14orf173 antibody
- CMTDIE antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-INF2 antibody (ab121114)Immunohistochemical analaysis of human stomach tissue labelling INF2 with ab121114 at 1/50 dilution. Moderate to strong cytoplasmic positivity in glandular cells is shown.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-INF2 antibody (ab121114)Immunohistochemical analaysis of human kidneytissue labelling INF2 with ab121114 at 1/50 dilution. Moderate cytoplasmic positivity in podocytes and cells in tubules is shown.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-INF2 antibody (ab121114)Immunohistochemical analaysis of human skeletal muscle labelling INF2 with ab121114 at 1/50 dilution. Moderate cytoplasmic positivity in neurons is shown.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-INF2 antibody (ab121114)Immunohistochemical analaysis of human skeletal muscle labelling INF2 with ab121114 at 1/50 dilution. No cytoplasmic postitivity is shown in striated muscle fibres.
Protocols
Datasheets and documents
References (0)
ab121114 has not yet been referenced specifically in any publications.
