Anti-INF2 antibody (ab121114)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-INF2 antibody
See all INF2 primary antibodies -
Description
Rabbit polyclonal to INF2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human INF2 aa 88-232.
Sequence:GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNV MVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNEL SG SDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR
Database link: Q27J81 -
Positive control
- IHC-P: INF2 transfected HEK293T cells, Human stomach tissue, U-251MG cells
-
General notes
This product was previously labelled as C14orf151
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab121114 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Use buffer at pH 6 for antigen retrieval. |
Target
-
Function
Severs actin filaments and accelerates their polymerization and depolymerization. -
Tissue specificity
Widely expressed. In the kidney, expression is apparent in podocytes and some tubule cells. -
Involvement in disease
Defects in INF2 are the cause of focal segmental glomerulosclerosis type 5 (FSGS5) [MIM:613237]. A renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and edema. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation. -
Sequence similarities
Belongs to the formin homology family.
Contains 1 FH2 (formin homology 2) domain.
Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
Contains 1 WH2 domain. -
Domain
The WH2 domain acts as the DAD (diaphanous autoregulatory) domain and binds to actin monomers.
Regulated by autoinhibition due to intramolecular GBD-DAD binding.
The severing activity is dependent on covalent attachment of the FH2 domain to the C-terminus. -
Cellular localization
Cytoplasm > perinuclear region. - Information by UniProt
-
Database links
- Entrez Gene: 64423 Human
- Omim: 610982 Human
- SwissProt: Q27J81 Human
- Unigene: 24956 Human
-
Alternative names
- C14orf151 antibody
- C14orf173 antibody
- CMTDIE antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-INF2 antibody (ab121114)
Immunohistochemical analaysis of human stomach tissue labelling INF2 with ab121114 at 1/50 dilution. Moderate to strong cytoplasmic positivity in glandular cells is shown.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-INF2 antibody (ab121114)
Immunohistochemical analaysis of human kidneytissue labelling INF2 with ab121114 at 1/50 dilution. Moderate cytoplasmic positivity in podocytes and cells in tubules is shown.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-INF2 antibody (ab121114)
Immunohistochemical analaysis of human skeletal muscle labelling INF2 with ab121114 at 1/50 dilution. Moderate cytoplasmic positivity in neurons is shown.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-INF2 antibody (ab121114)
Immunohistochemical analaysis of human skeletal muscle labelling INF2 with ab121114 at 1/50 dilution. No cytoplasmic postitivity is shown in striated muscle fibres.
Protocols
Datasheets and documents
References
ab121114 has not yet been referenced specifically in any publications.