Overview

  • Product name

  • Description

    Rabbit polyclonal to INF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human INF2 aa 88-232.
    Sequence:

    GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNV MVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNEL SG SDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR


    Database link: Q27J81

  • Positive control

    • IHC-P: INF2 transfected HEK293T cells, Human stomach tissue, U-251MG cells
  • General notes

     This product was previously labelled as C14orf151

     

Properties

Applications

Our Abpromise guarantee covers the use of ab121114 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Use buffer at pH 6 for antigen retrieval.

Target

  • Function

    Severs actin filaments and accelerates their polymerization and depolymerization.
  • Tissue specificity

    Widely expressed. In the kidney, expression is apparent in podocytes and some tubule cells.
  • Involvement in disease

    Defects in INF2 are the cause of focal segmental glomerulosclerosis type 5 (FSGS5) [MIM:613237]. A renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and edema. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation.
  • Sequence similarities

    Belongs to the formin homology family.
    Contains 1 FH2 (formin homology 2) domain.
    Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
    Contains 1 WH2 domain.
  • Domain

    The WH2 domain acts as the DAD (diaphanous autoregulatory) domain and binds to actin monomers.
    Regulated by autoinhibition due to intramolecular GBD-DAD binding.
    The severing activity is dependent on covalent attachment of the FH2 domain to the C-terminus.
  • Cellular localization

    Cytoplasm > perinuclear region.
  • Information by UniProt
  • Database links

  • Alternative names

    • C14orf151 antibody
    • C14orf173 antibody
    • CMTDIE antibody
    • DKFZp762A0214 antibody
    • FLJ22056 antibody
    • FSGS5 antibody
    • HBEAG binding protein 2 binding protein C antibody
    • HBEBP2 binding protein C antibody
    • HBEBP2-binding protein C antibody
    • INF 2 antibody
    • inf2 antibody
    • INF2_HUMAN antibody
    • Inverted formin 2 antibody
    • Inverted formin FH2 and WH2 domain containing antibody
    • Inverted formin-2 antibody
    • MGC13251 antibody
    • pp9484 antibody
    see all

Images

  • Immunohistochemical analaysis of human stomach tissue labelling INF2 with ab121114 at 1/50 dilution. Moderate to strong cytoplasmic positivity in glandular cells is shown.

  • Immunohistochemical analaysis of human kidneytissue labelling INF2 with ab121114 at 1/50 dilution. Moderate cytoplasmic positivity in podocytes and cells in tubules is shown.

  • Immunohistochemical analaysis of human skeletal muscle labelling INF2 with ab121114 at 1/50 dilution. Moderate cytoplasmic positivity in neurons is shown.

  • Immunohistochemical analaysis of human skeletal muscle labelling INF2 with ab121114 at 1/50 dilution. No cytoplasmic postitivity is shown in striated muscle fibres.

References

ab121114 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121114.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up