Overview

  • Product name

  • Description

    Rabbit polyclonal to ING2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ING2 aa 1-90.
    Sequence:

    MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLR ELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRAL


    Database link: Q9H160

  • Positive control

    • ICC/IF: U-2 OS cells. WB: ING2 overexpression HEK-293T cell lysate. IHC-P: Human gallbladder tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Seems to be involved in p53/TP53 activation and p53/TP53-dependent apoptotic pathways, probably by enhancing acetylation of p53/TP53. Component of a mSin3A-like corepressor complex, which is probably involved in deacetylation of nucleosomal histones. ING2 activity seems to be modulated by binding to phosphoinositides (PtdInsPs).
  • Tissue specificity

    Widely expressed. Higher expressed in colon-cancer tumor than in normal colon tissues.
  • Sequence similarities

    Belongs to the ING family.
    Contains 1 PHD-type zinc finger.
  • Domain

    The PHD-type zinc finger domain binds to phosphoinositides (PtdInsPs), including phosphatidylinositol 5-phosphate (PtdIns(5)P).
  • Cellular localization

    Nucleus. Predominantly nuclear. Localized to chromatin and nuclear matrix. Upon reduced PtdIns(5)P levels seems to be released from chromatin and, at least partially, translocated to the cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ING 1 like tumor suppressor protein antibody
    • ING 1L antibody
    • ING 2 antibody
    • ING1 like tumor suppressor protein antibody
    • ING1L antibody
    • ING1Lp antibody
    • ING2 antibody
    • ING2_HUMAN antibody
    • Inhibitor of growth 1 like antibody
    • Inhibitor of growth 1 like protein antibody
    • Inhibitor of growth 1-like protein antibody
    • Inhibitor of growth family member 1 like antibody
    • Inhibitor of growth family member 2 antibody
    • Inhibitor of growth protein 2 antibody
    • p32 antibody
    • p33 ING2 antibody
    • p33ING2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for ING2 (green) using ab244387 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human gallbladder tissue stained for ING2 using ab244387 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-ING2 antibody (ab244387) at 0.4 µg/ml

    Lane 1 : Vector only transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : ING2 overexpression HEK-293T cell lysate

References

ab244387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244387.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up