Overview

  • Product name

    Anti-Inhibin alpha antibody
    See all Inhibin alpha primary antibodies
  • Description

    Rabbit polyclonal to Inhibin alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Mouse Inhibin alpha aa 316-366 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    QPLFLVPGAKPCCAALPGSMRSLRVRTTSDGGYSFKYEMVPNLITQHCAC I


    Database link: Q04997

  • Positive control

    • Rat ovary tissue; Rat brain and kidney lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab216969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Detects a band of approximately 39 kDa (predicted molecular weight: 40 kDa).
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
  • Tissue specificity

    Originally found in ovary (granulosa cells) and testis (Sertoli cells), but widely distributed in many tissues including brain and placenta. In adrenal cortex expression is limited to the zona reticularis and the innermost zona fasciculata in the normal gland, extending centripetally into the zona fasciculata in hyperplasia. Also found in adrenocortical tumors. Also expressed in prostate epithelium of benign prostatic hyperplasia, in regions of basal cell hyperplasia and in nonmalignant regions of high grade prostate cancer. Only circulating inhibin B is found in male, whereas circulating inhibins A and B are found in female.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Post-translational
    modifications

    Proteolytic processing yields a number of bioactive forms. The 20/23 kDa forms consist solely of the mature alpha chain, the 26/29 kDa forms consist of the most N-terminal propeptide linked through a disulfide bond to the mature alpha chain, the 50/53 kDa forms encompass the entire proprotein. Each type can be furthermore either mono- or diglycosylated, causing the mass difference.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • A inhibin subunit antibody
    • A inhibin subunit precursor antibody
    • AW55578 antibody
    • IHA antibody
    • inhA antibody
    • INHA_HUMAN antibody
    • Inhibin alpha chain antibody
    • Inhibin alpha chain precursor antibody
    • Inhibin alpha subunit antibody
    see all

Images

  • All lanes :

    Lane 1 : rat brain lysate
    Lane 2 : rat kidney lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP at 1/3000 dilution

    Predicted band size: 40 kDa



    12% gel.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat ovary tissue labeling Inhibin alpha with ab216969 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab216969 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up