Overview

  • Product name

    Anti-INKA2 antibody
  • Description

    Rabbit polyclonal to INKA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Cow, Cat, Human
  • Immunogen

    Synthetic peptide corresponding to Rat INKA2 aa 161-210 (internal sequence).
    Sequence:

    DNVFADLVGNWLDLPELEKGGERGETGGSGEPKGEKGQSRELGRKFALTA


    Database link: NP_001101183

  • Positive control

    • Rat brain lysate
  • General notes

     This product was previously labelled as Fam212b

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab128263 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-INKA2 antibody (ab128263) at 1 µg/ml + Rat brain lysate at 10 µg

    Predicted band size: 32 kDa



    Gel concentration 12%

References

ab128263 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab128263.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up