Overview

  • Product name

  • Description

    Rabbit polyclonal to INPP4A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human INPP4A aa 1-250.
    Sequence:

    MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSL ACSELHTPSLDRKPNSFVAVSVTTPPQAFWTKHAQTEIIEGTNNPIFLSS IAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIVKDLLQDRHHR LHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDE SLTEALGIRSKYASLRKDTLLKSVFGGAICRMYRFPTTDGNHLRILEQMA


    Database link: Q96PE3

  • Positive control

    • WB: Mouse brain lysate. IHC-P: Human brain and heart tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 110 kDa.

Target

  • Function

    Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-bisphosphate.
  • Tissue specificity

    Isoform 1 is expressed in the platelets, MEG-01 megakaryocytes and Jurkat T-cells. Isoform 2 is expressed in the brain.
  • Pathway

    Signal transduction; phosphatidylinositol signaling pathway.
  • Sequence similarities

    Belongs to the inositol-3,4-bisphosphate 4-phosphatase family.
    Contains 1 C2 domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 107kDa antibody
    • 4-bisphosphate 4-phosphatase antibody
    • 9630012D15 antibody
    • D130048C09Rik antibody
    • Inositol polyphosphate 4 phosphatase type I 107kDa antibody
    • Inositol polyphosphate 4 phosphatase type I antibody
    • Inositol polyphosphate 4-phosphatase type I antibody
    • INP4A_HUMAN antibody
    • INPP4 antibody
    • Inpp4a antibody
    • OTTHUMP00000203138 antibody
    • OTTHUMP00000203139 antibody
    • OTTHUMP00000203141 antibody
    • OTTHUMP00000225217 antibody
    • R74740 antibody
    • TVAS1 antibody
    • Type I inositol 3 4 bisphosphate 4 phosphatase antibody
    • Type I inositol 3,4 bisphosphate 4 phosphatase antibody
    • Type I inositol-3 antibody
    see all

Images

  • Anti-INPP4A antibody (ab230398) at 1/1000 dilution + Mouse brain lysate

    Secondary
    Goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 110 kDa

  • Paraffin-embedded human brain tissue stained for INPP4A using ab230398 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human heart tissue stained for INPP4A using ab230398 at 1/100 dilution in immunohistochemical analysis.

References

ab230398 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230398.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up