Overview

  • Product name

    Anti-Insulin Receptor alpha antibody
    See all Insulin Receptor alpha primary antibodies
  • Description

    Rabbit polyclonal to Insulin Receptor alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human Insulin Receptor alpha aa 700-750 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    SEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSG T


    Database link: P06213

  • Positive control

    • IHC-P: Rat tongue, brain, lung and small intestine tissue; WB: Lymph node tissue; FC: HL-60 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab203037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/300 - 1/1000. Predicted molecular weight: 156 kDa.
Flow Cyt 1/100.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    The human insulin receptor is a heterotetrameric membrane glycoprotein consisting of disulfide linked subunits in a beta-alpha-alpha-beta configuration. The beta subunit (95 kDa) possesses a single transmembrane domain, whereas the alpha subunit (135 kDa) is completely extracellular. The insulin receptor exhibits receptor tyrosine kinase (RTK) activity. RTKs are single pass transmembrane receptors that possess intrinsic cytoplasmic enzymatic activity, catalyzing the transfer of the gamma phosphate of ATP to tyrosine residues in protein substrates. RTKs are essential components of signal transduction pathways that affect cell proliferation, differentiation, migration and metabolism. Included in this large protein family are the insulin receptor and the receptors for growth factors such as epidermal growth factor, fibroblast growth factor and vascular endothelial growth factor. Receptor activation occurs through ligand binding, which facilitates receptor dimerization and autophosphorylation of specific tyrosine residues in the cytoplasmic portion. The interaction of insulin with the alpha subunit of the insulin receptor activates the protein tyrosine kinase of the beta subunit, which then undergoes an autophosphorylation that increases its tyrosine kinase activity. Three adapter proteins, IRS1, IRS2 and Shc, become phosphorylated on tyrosine residues following insulin receptor activation. These three phosphorylated proteins then interact with SH2 domain containing signaling proteins.
  • Cellular localization

    Membrane; single pass type I membrane protein.
  • Database links

  • Alternative names

    • CD220 antibody
    • HHF5 antibody
    • HIR A antibody
    • INSR antibody
    • Insulin receptor antibody
    • Insulin receptor subunit alpha antibody
    • IR antibody
    see all

Images

  • Anti-Insulin Receptor alpha antibody (ab203037) at 1/300 dilution + Lymph node whole tissue lysate

    Predicted band size: 156 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat tongue tissue labeling Insulin Receptor with ab203037 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat small intestine tissue labeling Insulin Receptor alpha with ab203037 at 1/200 dilution, followed by conjugated Goat Anti-Rabbit IgG secondary antibody. DAPI was used as nuclear counterstain. Heat mediated antigen retrieval with sodium citrate buffer, pH 6 was performed for 15 minutes.

  • Flow cytometric analysis of HL-60 cells labelleing insulin receptor alpha with ab203037 at 1/100 dilution (green), compared to control cells (blue) and isotype control (orange).

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat small brain tissue labeling Insulin Receptor alpha with ab203037 at 1/200 dilution, followed by conjugated Goat Anti-Rabbit IgG secondary antibody. DAPI was used as nuclear counterstain. Heat mediated antigen retrieval with sodium citrate buffer, pH 6 was performed for 15 minutes.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat lung tissue labeling Insulin Receptor alpha with ab203037 at 1/200 dilution, followed by conjugated Goat Anti-Rabbit IgG secondary antibody. DAPI was used as nuclear counterstain. Heat mediated antigen retrieval with sodium citrate buffer, pH 6 was performed for 15 minutes.

References

ab203037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up