Overview

  • Product name

  • Description

    Rabbit polyclonal to Int1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Int1 aa 289-379.
    Sequence:

    LTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLN RRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPK

  • Positive control

    • Human thyroid gland tissue
  • General notes

    Previously labelled as INTS1. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/900. Perform heat mediated antigen retrieval via the pressure cooker method before commencing with IHC staining protocol. Use buffer at pH 6 for antigen retrieval.

Target

  • Function

    Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes.
  • Sequence similarities

    Belongs to the Integrator subunit 1 family.
  • Cellular localization

    Nucleus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Int1 antibody
    • INT1_HUMAN antibody
    • Integrator complex subunit 1 antibody
    • ints1 antibody
    • NET28 antibody
    see all

Images

  • Immunohistochemical staining of paraffin embedded Human thyroid gland tissue, using 1/900 ab121692.

References

ab121692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up