Overview

  • Product name

    Anti-Integrin alpha 2 antibody
    See all Integrin alpha 2 primary antibodies
  • Description

    Rabbit polyclonal to Integrin alpha 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Pig
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Integrin alpha 2 aa 74-277. N-terminal His-tag and S-tag. Expressed in E.coli.
    Sequence:

    MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS EFENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILTR NMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPATQPCPS LIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPR VVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGR RSATKV


    Database link: P17301

  • Positive control

    • WB: Porcine and mouse intestine tissue; Recombinant human integrin alpha 2 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.

Target

  • Function

    Integrin alpha-2/beta-1 is a receptor for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. It is responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix.
  • Sequence similarities

    Belongs to the integrin alpha chain family.
    Contains 7 FG-GAP repeats.
    Contains 1 VWFA domain.
  • Domain

    The integrin I-domain (insert) is a VWFA domain. Integrins with I-domains do not undergo protease cleavage.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BR antibody
    • CD 49b antibody
    • CD49 antigen like family member B antibody
    • CD49 antigen-like family member B antibody
    • CD49b antibody
    • CD49b antigen antibody
    • Collagen receptor antibody
    • DX5 antibody
    • Glycoprotein Ia deficiency included antibody
    • GP Ia antibody
    • GP Ia deficiency, included antibody
    • GPIa antibody
    • HPA 5 included antibody
    • HPA5 included antibody
    • Human platelet alloantigen system 5 antibody
    • Integrin alpha 2 antibody
    • Integrin alpha II antibody
    • Integrin alpha-2 antibody
    • Integrin, alpha 2 (CD49B alpha 2 subunit of VLA 2 receptor) antibody
    • ITA2_HUMAN antibody
    • ITGA2 antibody
    • Platelet alloantigen Br(a), included antibody
    • Platelet antigen Br antibody
    • Platelet glycoprotein GPIa antibody
    • Platelet glycoprotein Ia antibody
    • Platelet glycoprotein Ia/IIa antibody
    • Platelet membrane glycoprotein Ia antibody
    • Platelet receptor for collagen, deficiency of, included antibody
    • Very late activation protein 2 receptor alpha 2 subunit antibody
    • VLA 2 alpha chain antibody
    • VLA 2 antibody
    • VLA 2 subunit alpha antibody
    • VLA-2 subunit alpha antibody
    • VLA2 antibody
    • VLA2 receptor alpha 2 subunit antibody
    • VLAA2 antibody
    see all

Images

  • All lanes : Anti-Integrin alpha 2 antibody (ab231597) at 3 µg/ml

    Lane 1 : Porcine intestine tissue lysate
    Lane 2 : Mouse intestine tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-rabbit at 1/2000 dilution
  • Anti-Integrin alpha 2 antibody (ab231597) at 3 µg/ml + Recombinant human integrin alpha 2 protein.

References

ab231597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up