Overview

  • Product name

    Anti-Integrin alpha 3 antibody
    See all Integrin alpha 3 primary antibodies
  • Description

    Rabbit polyclonal to Integrin alpha 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Chinese hamster
  • Immunogen

    Synthetic peptide corresponding to Human Integrin alpha 3 aa 500-550.
    Sequence:

    NQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMR C


    Database link: P26006

  • Positive control

    • HepG2 cell extract.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    ab190731 purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. Purity >95% by SDS-PAGE.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190731 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 117 kDa.

Target

  • Function

    Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.
  • Tissue specificity

    Isoform alpha-3A is widely expressed. Isoform alpha-3B is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform alpha-3A is strongly expressed on vascular smooth muscle cells, isoform alpha-3B is detected only on endothelial vein cells.
  • Sequence similarities

    Belongs to the integrin alpha chain family.
    Contains 7 FG-GAP repeats.
  • Post-translational
    modifications

    Isoform alpha-3A, but not isoform alpha-3B, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12-myristate 13-acetate stimulation. Isoform alpha-3A is phosphorylated on Tyr-1051.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AA407068 antibody
    • Antigen identified by monoclonal antibody J143 antibody
    • CD49 antigen like family member C antibody
    • CD49 antigen-like family member C antibody
    • CD49c antibody
    • CD49c antigen antibody
    • FLJ34631 antibody
    • FLJ34704 antibody
    • FRP 2 antibody
    • FRP-2 antibody
    • FRP2 antibody
    • Galactoprotein B3 antibody
    • GAP B3 antibody
    • GAPB3 antibody
    • Integrin alpha 3 antibody
    • Integrin alpha-3 light chain antibody
    • Integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor) antibody
    • ITA3_HUMAN antibody
    • ITGA 3 antibody
    • Itga3 antibody
    • MSK18 antibody
    • VCA 2 antibody
    • VCA2 antibody
    • Very late activation protein 3 receptor alpha 3 subunit antibody
    • VL3A antibody
    • VLA 3 alpha chain antibody
    • VLA 3 subunit alpha antibody
    • VLA-3 subunit alpha antibody
    • VLA3a antibody
    see all

Images

  • Anti-Integrin alpha 3 antibody (ab190731) + HepG2 cell extract

    Predicted band size: 117 kDa

References

This product has been referenced in:

  • Shen M  et al. Tinagl1 Suppresses Triple-Negative Breast Cancer Progression and Metastasis by Simultaneously Inhibiting Integrin/FAK and EGFR Signaling. Cancer Cell 35:64-80.e7 (2019). IP ; Rabbit . Read more (PubMed: 30612941) »
  • Aleckovic M  et al. Identification of Nidogen 1 as a lung metastasis protein through secretome analysis. Genes Dev 31:1439-1455 (2017). Read more (PubMed: 28827399) »
See all 3 Publications for this product

Customer reviews and Q&As

1-6 of 6 Abreviews or Q&A

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (undifferentiated Human ES cells on MEFs)
Permeabilization
Yes - See blocking buffer
Specification
undifferentiated Human ES cells on MEFs
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: rt°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Feb 23 2016

Application
Western blot
Sample
Human Cell lysate - whole cell (HUES7 ES cells)
Gel Running Conditions
Reduced Denaturing (12%)
Loading amount
20 µg
Specification
HUES7 ES cells
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 16°C

Abcam user community

Verified customer

Submitted Feb 22 2016

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HEPG2)
Specification
HEPG2
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: rt°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Nov 18 2015

Application
Western blot
Sample
Human Cell lysate - whole cell (HEPG2)
Gel Running Conditions
Reduced Denaturing (12.5)
Loading amount
20 µg
Specification
HEPG2
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 4°C

Abcam user community

Verified customer

Submitted Nov 13 2015

Application
Immunocytochemistry/ Immunofluorescence
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 16°C
Sample
Mouse Cell (embryonic stem cell)
Specification
embryonic stem cell
Permeabilization
Yes - 0.1% triton X
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Sep 22 2014

Application
Western blot
Loading amount
5000 cells
Gel Running Conditions
Reduced Denaturing (8% gel)
Sample
Mouse Cell lysate - whole cell (mouse embryonic stem cells)
Specification
mouse embryonic stem cells
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 16°C

Abcam user community

Verified customer

Submitted Sep 22 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up