Overview

  • Product name

    Anti-Integrin alpha 3b antibody [54B3]
  • Description

    Mouse monoclonal [54B3] to Integrin alpha 3b
  • Host species

    Mouse
  • Specificity

    Recognizes specifically the cytoplasmic domain of integrin subunit a3B which is present in microvascular structures in brain and heart.
  • Tested applications

    Suitable for: WB, IHC-Fr, ICCmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: a wide range of other species
  • Immunogen

    Synthetic peptide: C-TRYYQIMPKYHAVRIREEERYPPPGSTLPTKK conjugated to KLH.

  • Epitope

    Cytoplasmic domain of a3B Integrin.
  • General notes


    The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Primary antibody notes

    The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha and a beta subunit in interconnecting the cytoskeleton and the extracellular matrix.
  • Clonality

    Monoclonal
  • Clone number

    54B3
  • Myeloma

    Sp2/0
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab8988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000.
IHC-Fr 1/25 - 1/200.
ICC Use at an assay dependent concentration.

Target

  • Relevance

    Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • CD49C antibody
    • GAPB3 antibody
    • Integrin alpha-3 heavy chain antibody
    • Integrin alpha-3 light chain antibody
    • ITGA3 antibody
    • MSK18 antibody
    • VL3A antibody
    see all

References

This product has been referenced in:

  • Khalkar P  et al. Selenite and methylseleninic acid epigenetically affects distinct gene sets in myeloid leukemia: A genome wide epigenetic analysis. Free Radic Biol Med 117:247-257 (2018). WB ; Human . Read more (PubMed: 29438720) »
  • Tobiasson M  et al. Comprehensive mapping of the effects of azacitidine on DNA methylation, repressive/permissive histone marks and gene expression in primary cells from patients with MDS and MDS-related disease. Oncotarget 8:28812-28825 (2017). Read more (PubMed: 28427179) »
See all 5 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab8988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up