Overview

  • Product name

    Anti-Integrin alpha 4/CD49D antibody
    See all Integrin alpha 4/CD49D primary antibodies
  • Description

    Rabbit polyclonal to Integrin alpha 4/CD49D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Integrin alpha 4/CD49D aa 886-974.
    Sequence:

    RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALK FEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR


    Database link: P13612

  • Positive control

    • ICC/IF: HaCaT cells.
  • General notes

     This product was previously labelled as Integrin alpha 4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab244548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha-4/beta-1 recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-4/beta-7 is also a receptor for MADCAM1. It recognizes the sequence L-D-T in MADCAM1. On activated endothelial cells integrin VLA-4 triggers homotypic aggregation for most VLA-4-positive leukocyte cell lines. It may also participate in cytolytic T-cell interactions with target cells.
  • Sequence similarities

    Belongs to the integrin alpha chain family.
    Contains 7 FG-GAP repeats.
  • Domain

    The SG1 motif is involved in binding to chondroitin sulfate glycosaminoglycan and cell adhesion.
  • Post-translational
    modifications

    Phosphorylation on Ser-1027 inhibits PXN binding.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 269C wild type antibody
    • Antigen CD49D, alpha 4 subunit of VLA 4 receptor antibody
    • CD49 antigen like family member D antibody
    • CD49 antigen-like family member D antibody
    • CD49d antibody
    • IA4 antibody
    • Integrin alpha 4 antibody
    • Integrin alpha 4 subunit antibody
    • Integrin alpha IV antibody
    • Integrin alpha-4 antibody
    • Integrin alpha-IV antibody
    • Integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA 4 receptor) antibody
    • ITA4_HUMAN antibody
    • ITGA4 antibody
    • MGC90518 antibody
    • OTTHUMP00000205320 antibody
    • Very late activation protein 4 receptor, alpha 4 subunit antibody
    • VLA 4 subunit alpha antibody
    • VLA-4 subunit alpha antibody
    • VLA4 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HaCaT (Human keratinocyte cell line) cells stained for Integrin alpha 4/CD49D (green) using ab244548 at 4 µg/ml in ICC/IF.

References

ab244548 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244548.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up