Overview

  • Product name

    Anti-Integrin beta 1 + Integrin alpha 3 antibody
  • Description

    Rabbit polyclonal to Integrin beta 1 + Integrin alpha 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    This product was produced with the following immunogens:
    Synthetic peptide within Human Integrin alpha 3 aa 976-1025 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRARTR


    Database link: P26006

    Synthetic peptide within Human Integrin beta 1 aa 35-47 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence: CGECIQAGPNCGW
    Database link: P05556

  • Positive control

    • Rat pancreas tissue; Mouse lung lysates; MCF7 and U138 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab217145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/100 - 1/1000. Predicted molecular weight: 117 kDa.
IHC-P 1/100 - 1/500.

Target

  • Cellular localization

    Integrin beta 1: Cell membrane, sarcolemma. Cell junction. In cardiac muscle, isoform 5 is found in costameres and intercalated disks and Cell membrane. Cell projection, invadopodium membrane. Cell projection, ruffle membrane. Recycling endosome. Melanosome. Cleavage furrow. Cell projection, lamellipodium. Cell projection, ruffle. Cell junction, focal adhesion. Cell surface. Isoform 2 does not localize to focal adhesions. Highly enriched in stage I melanosomes. Located on plasma membrane of neuroblastoma NMB7 cells. In a lung cancer cell line, in prometaphase and metaphase, localizes diffusely at the membrane and in a few intracellular vesicles. In early telophase, detected mainly on the matrix-facing side of the cells. By mid-telophase, concentrated to the ingressing cleavage furrow, mainly to the basal side of the furrow. In late telophase, concentrated to the extending protrusions formed at the opposite ends of the spreading daughter cells, in vesicles at the base of the lamellipodia formed by the separating daughter cells. Colocalizes with ITGB1BP1 and metastatic suppressor protein NME2 at the edge or peripheral ruffles and lamellipodia during the early stages of cell spreading on fibronectin or collagen. Translocates from peripheral focal adhesions sites to fibrillar adhesions in a ITGB1BP1-dependent manner. Enriched preferentially at invadopodia, cell membrane protrusions that correspond to sites of cell invasion, in a collagen-dependent manner. Localized at plasma and ruffle membranes in a collagen-independent manner. Integrin alpha 3: Membrane.
  • Database links

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat pancreas tissue labeling Integrin alpha 3+beta 1 with ab217145 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Anti-Integrin beta 1 + Integrin alpha 3 antibody (ab217145) at 1/300 dilution + Mouse lung lysate

    Secondary
    Goat Anti-Goat Anti-Rabbit IgG Antibody (H+L), HRP at 1/500 dilution

    Predicted band size: 117 kDa

References

ab217145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up