Anti-Integrin beta 4 binding protein antibody (ab175383)

Overview

  • Product name
    Anti-Integrin beta 4 binding protein antibody
    See all Integrin beta 4 binding protein primary antibodies
  • Description
    Rabbit polyclonal to Integrin beta 4 binding protein
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Xenopus laevis, Zebrafish
  • Immunogen

    Recombinant full length protein corresponding to Human Integrin beta 4 binding protein aa 1-245.
    Sequence:

    MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVH ASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEER LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGS YCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVN DWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT


    Database link: P56537

  • Positive control
    • COLO320 cell extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab175383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 27 kDa.

Target

  • Function
    Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm. May behave as a stimulatory translation initiation factor downstream insulin/growth factors. Is also involved in ribosome biogenesis. Associates with pre-60S subunits in the nucleus and is involved in its nuclear export. Cytoplasmic release of TIF6 from 60S subunits and nuclear relocalization is promoted by a RACK1 (GNB2L1)-dependent protein kinase C activity.
  • Tissue specificity
    Expressed at very high levels in colon carcinoma with lower levels in normal colon and ileum and lowest levels in kidney and muscle (at protein level).
  • Sequence similarities
    Belongs to the eIF-6 family.
  • Post-translational
    modifications
    Phosphorylation at Ser-174 and Ser-175 promotes nuclear export.
  • Cellular localization
    Cytoplasm. Nucleus > nucleolus. Shuttles between cytoplasm and nucleus/nucleolus.
  • Information by UniProt
  • Database links
  • Alternative names
    • b(2)gcn antibody
    • B(2)GCN homolog antibody
    • B4 integrin interactor antibody
    • Binding protein of beta-4 integrin antibody
    • CAB antibody
    • eIF-6 antibody
    • EIF3A antibody
    • EIF6 antibody
    • Eukaryotic translation initiation factor 3A antibody
    • Eukaryotic translation initiation factor 6 antibody
    • IF6_HUMAN antibody
    • ITGB4BP antibody
    • OK/SW-cl.27 antibody
    • p27 beta 4 integrin binding protein antibody
    • p27(BBP) antibody
    • p27BBP antibody
    • RP4-614O4.1 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175383. Blue DAPI for nuclear staining.
  • Anti-Integrin beta 4 binding protein antibody (ab175383) at 1/500 dilution + COLO320 cell extract

    Predicted band size: 27 kDa

References

ab175383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up