Anti-Integrin beta 8 antibody [CL7290] (ab243023)

Submit a review Submit a question
Immunocytochemistry/ Immunofluorescence - Anti-Integrin beta 8 antibody [CL7290] (ab243023)
  • Western blot - Anti-Integrin beta 8 antibody [CL7290] (ab243023)

Key features and details

  • Mouse monoclonal [CL7290] to Integrin beta 8
  • Suitable for: WB, ICC/IF
  • Reacts with: Human
  • Isotype: IgG1

Overview

  • Product name

    Anti-Integrin beta 8 antibody [CL7290]
    See all Integrin beta 8 primary antibodies

  • Description

    Mouse monoclonal [CL7290] to Integrin beta 8

  • Host species

    Mouse

  • Tested applications

    Suitable for: WB, ICC/IFmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit

  • Immunogen

    Recombinant fragment corresponding to Human Integrin beta 8 aa 590-669.
    Sequence:

    AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWN CMQCLHPHNLSQAILDQCKTSCALMEQQHY


    Database link: P26012
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • ICC/IF: WM-115 cells. WB: WM-115 cell lysate.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), PBS
  • Concentration information loading...

  • Purity

    Protein A purified

  • Purification notes

    Purified from TCS.

  • Clonality

    Monoclonal

  • Clone number

    CL7290

  • Isotype

    IgG1

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 86 kDa.
ICC/IF Use a concentration of 2 - 10 mg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-Integrin beta 8 antibody [CL7290] (ab243023)
    Immunocytochemistry/ Immunofluorescence - Anti-Integrin beta 8 antibody [CL7290] (ab243023)

    Immunocytochemistry/Immunofluorescence analysis of WM-115 cells labeling Integrin beta 8 using ab243023 at 4 µg/ml (green). Nuclear probe is visualized in blue, microtubules in red.

  • Western blot - Anti-Integrin beta 8 antibody [CL7290] (ab243023)
    Western blot - Anti-Integrin beta 8 antibody [CL7290] (ab243023)
    Anti-Integrin beta 8 antibody [CL7290] (ab243023) at 1 µg/ml + Human eye tissue lysate

    Predicted band size: 86 kDa

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

References (0)

Publishing research using ab243023? Please let us know so that we can cite the reference in this datasheet.

ab243023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab243023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com