Anti-Integrin beta 8 antibody [CL7290] (ab243023)
Key features and details
- Mouse monoclonal [CL7290] to Integrin beta 8
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Integrin beta 8 antibody [CL7290]
See all Integrin beta 8 primary antibodies -
Description
Mouse monoclonal [CL7290] to Integrin beta 8 -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit -
Immunogen
Recombinant fragment corresponding to Human Integrin beta 8 aa 590-669.
Sequence:AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWN CMQCLHPHNLSQAILDQCKTSCALMEQQHY
Database link: P26012 -
Positive control
- ICC/IF: WM-115 cells. WB: WM-115 cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Clone number
CL7290 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab243023 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 86 kDa. | |
ICC/IF | Use a concentration of 2 - 10 mg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Integrin alpha-V/beta-8 is a receptor for fibronectin. -
Tissue specificity
Placenta, kidney, brain, ovary, uterus and in several transformed cells. Transiently expressed in 293 human embryonic kidney cells. -
Sequence similarities
Belongs to the integrin beta chain family.
Contains 1 VWFA domain. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 3696 Human
- Entrez Gene: 100009141 Rabbit
- Omim: 604160 Human
- SwissProt: P26012 Human
- SwissProt: P26013 Rabbit
- Unigene: 592171 Human
-
Alternative names
- Integrin beta-8 antibody
- ITB8_HUMAN antibody
- ITGB 8 antibody
- ITGB8 antibody
Images
-
Immunocytochemistry/Immunofluorescence analysis of WM-115 cells labeling Integrin beta 8 using ab243023 at 4 µg/ml (green). Nuclear probe is visualized in blue, microtubules in red.
-
Anti-Integrin beta 8 antibody [CL7290] (ab243023) at 1 µg/ml + Human eye tissue lysate
Predicted band size: 86 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243023 has not yet been referenced specifically in any publications.